Back to index

python-biopython  1.60
Namespaces | Functions | Variables
test_SeqUtils.py File Reference

Go to the source code of this file.

Namespaces

namespace  test_SeqUtils

Functions

def test_SeqUtils.u_crc32
def test_SeqUtils.simple_LCC
def test_SeqUtils.windowed_LCC

Variables

string test_SeqUtils.dna_fasta_filename = "Fasta/f002"
 quick_FASTA_reader #
tuple test_SeqUtils.tuple_records = quick_FASTA_reader(dna_fasta_filename)
tuple test_SeqUtils.seq_records = list(SeqIO.parse(open(dna_fasta_filename),"fasta"))
tuple test_SeqUtils.CAI = CodonAdaptationIndex()
 CodonUsage #.
string test_SeqUtils.dna_genbank_filename = "GenBank/NC_005816.gb"
tuple test_SeqUtils.record = SeqIO.read(open(dna_genbank_filename), "genbank")
list test_SeqUtils.records = []
 test_SeqUtils.start = feature.location.start.position
 test_SeqUtils.end = feature.location.end.position
tuple test_SeqUtils.table = int(feature.qualifiers["transl_table"][0])
list test_SeqUtils.seq = record.seq[start:end]
string test_SeqUtils.a = "M"
list test_SeqUtils.b = feature.qualifiers["translation"]
list test_SeqUtils.description = feature.qualifiers["product"]
tuple test_SeqUtils.handle = open(dna_fasta_filename, "w")
string test_SeqUtils.str_light_chain_one = "QSALTQPASVSGSPGQSITISCTGTSSDVGSYNLVSWYQQHPGK"
 crc64 collision #
string test_SeqUtils.str_light_chain_two = "QSALTQPASVSGSPGQSITISCTGTSSDVGSYNLVSWYQQHPGK"
list test_SeqUtils.examples
 main checksum/LCC tests #
tuple test_SeqUtils.value = checksum(seq_str)