Back to index

python-biopython  1.60
Go to the documentation of this file.
00001 # Copyright 2008 by Bartek Wilczynski.  All rights reserved.
00002 # Adapted from by Jeff Chang
00003 # This code is part of the Biopython distribution and governed by its
00004 # license.  Please see the LICENSE file that should have been included
00005 # as part of this package.
00007 import os
00008 import unittest
00010 from Bio import Motif
00011 from Bio.Seq import Seq
00013 class MotifTestsBasic(unittest.TestCase):
00014     def setUp(self):
00015         self.PFMin = open("Motif/SRF.pfm")
00016         self.SITESin = open("Motif/Arnt.sites")
00017         self.TFout = "Motif/tf.out"
00018         self.FAout = "Motif/fa.out"
00019         self.PFMout = "Motif/fa.out"
00020         self.m=Motif.Motif()
00021         self.m.add_instance(Seq("ATATA",self.m.alphabet))
00023     def tearDown(self):
00024         self.PFMin.close()
00025         self.SITESin.close()
00026         if os.path.exists(self.TFout):
00027             os.remove(self.TFout)
00028         if os.path.exists(self.FAout):
00029             os.remove(self.FAout)
00031     def test_alignace_parsing(self):
00032         """Test if Motif can parse AlignAce output files.
00033         """
00034         from Bio.Alphabet import IUPAC
00035         from Bio.Motif.Parsers import AlignAce
00036         handle = open("Motif/alignace.out")
00037         record =
00038         handle.close()
00039         self.assertEqual(record.ver, "AlignACE 4.0 05/13/04\n")
00040         self.assertEqual(record.cmd_line, "./AlignACE -i test.fa \n")
00041         self.assertEqual(len(record.param_dict), 7)
00042         self.assertEqual(record.param_dict['expect'], "10")
00043         self.assertEqual(record.param_dict['gcback'], "0.38")
00044         self.assertEqual(record.param_dict['minpass'], "200")
00045         self.assertEqual(record.param_dict['seed'], "1227623309")
00046         self.assertEqual(record.param_dict['numcols'], "10")
00047         self.assertEqual(record.param_dict['undersample'], "1")
00048         self.assertEqual(record.param_dict['oversample'], "1")
00049         self.assertEqual(len(record.seq_dict), 10)
00050         self.assertEqual(record.seq_dict[0], "SEQ1; M: CTCAATCGTAGA at 52\n")
00051         self.assertEqual(record.seq_dict[1], "SEQ2; M: CTCAATCGTAGA at 172\n")
00052         self.assertEqual(record.seq_dict[2], "SEQ3; M: CTCAATCGTAGA at 112\n")
00053         self.assertEqual(record.seq_dict[3], "SEQ4; M: CTCAATCGTAGA at 173\n")
00054         self.assertEqual(record.seq_dict[4], "SEQ5; M: CTCAATCGTAGA at 185\n")
00055         self.assertEqual(record.seq_dict[5], "SEQ6; M: CTCAATCGTAGA at 105\n")
00056         self.assertEqual(record.seq_dict[6], "SEQ7; M: CTCAATCGTAGA at 177\n")
00057         self.assertEqual(record.seq_dict[7], "SEQ8; M: CTCAATCGTAGA at 172\n")
00058         self.assertEqual(record.seq_dict[8], "SEQ9; M: CTCAATCGTAGA at 93\n")
00059         self.assertEqual(record.seq_dict[9], "SEQ10; M: CTCAATCGTAGA at 3\n")
00060         self.assertEqual(len(record.motifs), 16)
00061         self.assertEqual(record.motifs[0].alphabet, IUPAC.unambiguous_dna)
00062         self.assertEqual(len(record.motifs[0].instances), 11)
00063         self.assertEqual(record.motifs[0].instances[0].tostring(), "TCTACGATTGAG")
00064         self.assertEqual(record.motifs[0].instances[1].tostring(), "TCTACGATTGAG")
00065         self.assertEqual(record.motifs[0].instances[2].tostring(), "TCTACGATTGAG")
00066         self.assertEqual(record.motifs[0].instances[3].tostring(), "TCTACGATTGAG")
00067         self.assertEqual(record.motifs[0].instances[4].tostring(), "TCTACGATTGAG")
00068         self.assertEqual(record.motifs[0].instances[5].tostring(), "TCTACGATTGAG")
00069         self.assertEqual(record.motifs[0].instances[6].tostring(), "TCTACGATTGAG")
00070         self.assertEqual(record.motifs[0].instances[7].tostring(), "TCTACGATTGAG")
00071         self.assertEqual(record.motifs[0].instances[8].tostring(), "TCTACGATTGAG")
00072         self.assertEqual(record.motifs[0].instances[9].tostring(), "TCAAAGATAGAG")
00073         self.assertEqual(record.motifs[0].instances[10].tostring(), "TCTACGATTGAG")
00074         self.assertEqual(record.motifs[0].mask, [1,1,0,1,1,1,1,1,0,1,1,1])
00075         self.assertAlmostEqual(record.motifs[0].score, 57.9079)
00076         self.assertEqual(record.motifs[1].alphabet, IUPAC.unambiguous_dna)
00077         self.assertEqual(len(record.motifs[1].instances), 22)
00078         self.assertEqual(record.motifs[1].instances[0].tostring(), "GCGAAGGAAGCAGCGCGTGTG")
00079         self.assertEqual(record.motifs[1].instances[1].tostring(), "GGCACCGCCTCTACGATTGAG")
00080         self.assertEqual(record.motifs[1].instances[2].tostring(), "CAGAGCTTAGCATTGAACGCG")
00081         self.assertEqual(record.motifs[1].instances[3].tostring(), "CTAATGAAAGCAATGAGAGTG")
00082         self.assertEqual(record.motifs[1].instances[4].tostring(), "CTTGTGCCCTCTAAGCGTCCG")
00083         self.assertEqual(record.motifs[1].instances[5].tostring(), "GAGCACGACGCTTTGTACCTG")
00084         self.assertEqual(record.motifs[1].instances[6].tostring(), "CGGCACTTAGCAGCGTATCGT")
00085         self.assertEqual(record.motifs[1].instances[7].tostring(), "CTGGTTTCATCTACGATTGAG")
00086         self.assertEqual(record.motifs[1].instances[8].tostring(), "GGGCCAATAGCGGCGCCGGAG")
00087         self.assertEqual(record.motifs[1].instances[9].tostring(), "GTGGAGTTATCTTAGTGCGCG")
00088         self.assertEqual(record.motifs[1].instances[10].tostring(), "GAGAGGTTATCTACGATTGAG")
00089         self.assertEqual(record.motifs[1].instances[11].tostring(), "CTGCTCCCCGCATACAGCGCG")
00090         self.assertEqual(record.motifs[1].instances[12].tostring(), "CAGAACCGAGGTCCGGTACGG")
00091         self.assertEqual(record.motifs[1].instances[13].tostring(), "GTGCCCCAAGCTTACCCAGGG")
00092         self.assertEqual(record.motifs[1].instances[14].tostring(), "CGCCTCTGATCTACGATTGAG")
00093         self.assertEqual(record.motifs[1].instances[15].tostring(), "GTGCTCATAGGGACGTCGCGG")
00094         self.assertEqual(record.motifs[1].instances[16].tostring(), "CTGCCCCCCGCATAGTAGGGG")
00095         self.assertEqual(record.motifs[1].instances[17].tostring(), "GTAAAGAAATCGATGTGCCAG")
00096         self.assertEqual(record.motifs[1].instances[18].tostring(), "CACCTGCAATTGCTGGCAGCG")
00097         self.assertEqual(record.motifs[1].instances[19].tostring(), "GGCGGGCCATCCCTGTATGAA")
00098         self.assertEqual(record.motifs[1].instances[20].tostring(), "CTCCAGGTCGCATGGAGAGAG")
00099         self.assertEqual(record.motifs[1].instances[21].tostring(), "CCTCGGATCGCTTGGGAAGAG")
00100         self.assertEqual(record.motifs[1].mask, [1,0,1,1,0,1,0,0,1,1,1,0,0,0,1,0,0,0,1,0,1])
00101         self.assertAlmostEqual(record.motifs[1].score, 19.6235)
00103         self.assertEqual(record.motifs[2].alphabet, IUPAC.unambiguous_dna)
00104         self.assertEqual(len(record.motifs[2].instances), 18)
00105         self.assertEqual(record.motifs[2].instances[0].tostring(), "GTGCGCGAAGGAAGCAGCGCG")
00106         self.assertEqual(record.motifs[2].instances[1].tostring(), "CAGAGCTTAGCATTGAACGCG")
00107         self.assertEqual(record.motifs[2].instances[2].tostring(), "GTGCCCGATGACCACCCGTCG")
00108         self.assertEqual(record.motifs[2].instances[3].tostring(), "GCCCTCTAAGCGTCCGCGGAT")
00109         self.assertEqual(record.motifs[2].instances[4].tostring(), "GAGCACGACGCTTTGTACCTG")
00110         self.assertEqual(record.motifs[2].instances[5].tostring(), "CGGCACTTAGCAGCGTATCGT")
00111         self.assertEqual(record.motifs[2].instances[6].tostring(), "GGGCCAATAGCGGCGCCGGAG")
00112         self.assertEqual(record.motifs[2].instances[7].tostring(), "GCGCACTAAGATAACTCCACG")
00113         self.assertEqual(record.motifs[2].instances[8].tostring(), "CGGCCCGTTGTCCAGCAGACG")
00114         self.assertEqual(record.motifs[2].instances[9].tostring(), "CTGCTCCCCGCATACAGCGCG")
00115         self.assertEqual(record.motifs[2].instances[10].tostring(), "GTGCCCCAAGCTTACCCAGGG")
00116         self.assertEqual(record.motifs[2].instances[11].tostring(), "GTGCTCATAGGGACGTCGCGG")
00117         self.assertEqual(record.motifs[2].instances[12].tostring(), "CTGCCCCCCGCATAGTAGGGG")
00118         self.assertEqual(record.motifs[2].instances[13].tostring(), "CGCCGCCATGCGACGCAGAGG")
00119         self.assertEqual(record.motifs[2].instances[14].tostring(), "AACCTCTAAGCATACTCTACG")
00120         self.assertEqual(record.motifs[2].instances[15].tostring(), "GACCTGGAGGCTTAGACTTGG")
00121         self.assertEqual(record.motifs[2].instances[16].tostring(), "GCGCTCTTCCCAAGCGATCCG")
00122         self.assertEqual(record.motifs[2].instances[17].tostring(), "GGGCCGTCAGCTCTCAAGTCT")
00123         self.assertEqual(record.motifs[2].mask, [1,0,1,1,0,1,0,0,0,1,1,0,0,0,1,0,1,0,0,1,1])
00124         self.assertAlmostEqual(record.motifs[2].score, 19.1804)
00126         self.assertEqual(record.motifs[3].alphabet, IUPAC.unambiguous_dna)
00127         self.assertEqual(len(record.motifs[3].instances), 16)
00128         self.assertEqual(record.motifs[3].instances[0].tostring(), "GCCCCAAGCTTACCCAGGGAC")
00129         self.assertEqual(record.motifs[3].instances[1].tostring(), "GCCGTCTGCTGGACAACGGGC")
00130         self.assertEqual(record.motifs[3].instances[2].tostring(), "GCCGACGGGTGGTCATCGGGC")
00131         self.assertEqual(record.motifs[3].instances[3].tostring(), "GCCAATAGCGGCGCCGGAGTC")
00132         self.assertEqual(record.motifs[3].instances[4].tostring(), "GCCCCCCGCATAGTAGGGGGA")
00133         self.assertEqual(record.motifs[3].instances[5].tostring(), "GCCCGTACCGGACCTCGGTTC")
00134         self.assertEqual(record.motifs[3].instances[6].tostring(), "GCCTCATGTACCGGAAGGGAC")
00135         self.assertEqual(record.motifs[3].instances[7].tostring(), "GACACGCGCCTGGGAGGGTTC")
00136         self.assertEqual(record.motifs[3].instances[8].tostring(), "GCCTTTGGCCTTGGATGAGAA")
00137         self.assertEqual(record.motifs[3].instances[9].tostring(), "GGCCCTCGGATCGCTTGGGAA")
00138         self.assertEqual(record.motifs[3].instances[10].tostring(), "GCATGTTGGGAATCCGCGGAC")
00139         self.assertEqual(record.motifs[3].instances[11].tostring(), "GACACGCGCTGTATGCGGGGA")
00140         self.assertEqual(record.motifs[3].instances[12].tostring(), "GCCAGGTACAAAGCGTCGTGC")
00141         self.assertEqual(record.motifs[3].instances[13].tostring(), "GCGATCAGCTTGTGGGCGTGC")
00142         self.assertEqual(record.motifs[3].instances[14].tostring(), "GACAAATCGGATACTGGGGCA")
00143         self.assertEqual(record.motifs[3].instances[15].tostring(), "GCACTTAGCAGCGTATCGTTA")
00144         self.assertEqual(record.motifs[3].mask, [1,1,1,0,0,0,0,1,1,0,0,0,0,1,0,0,1,1,1,0,1])
00145         self.assertAlmostEqual(record.motifs[3].score, 18.0097)
00146         self.assertEqual(record.motifs[4].alphabet, IUPAC.unambiguous_dna)
00147         self.assertEqual(len(record.motifs[4].instances), 15)
00148         self.assertEqual(record.motifs[4].instances[0].tostring(), "CGGCACAGAGCTT")
00149         self.assertEqual(record.motifs[4].instances[1].tostring(), "ATCCGCGGACGCT")
00150         self.assertEqual(record.motifs[4].instances[2].tostring(), "CGCCTGGGAGGGT")
00151         self.assertEqual(record.motifs[4].instances[3].tostring(), "CGGAAGGGACGTT")
00152         self.assertEqual(record.motifs[4].instances[4].tostring(), "ACACACAGACGGT")
00153         self.assertEqual(record.motifs[4].instances[5].tostring(), "TGCCAGAGAGGTT")
00154         self.assertEqual(record.motifs[4].instances[6].tostring(), "AGACTGAGACGTT")
00155         self.assertEqual(record.motifs[4].instances[7].tostring(), "AATCGTAGAGGAT")
00156         self.assertEqual(record.motifs[4].instances[8].tostring(), "CGTCTCGTAGGGT")
00157         self.assertEqual(record.motifs[4].instances[9].tostring(), "CGTCGCGGAGGAT")
00158         self.assertEqual(record.motifs[4].instances[10].tostring(), "CTTCTTAGACGCT")
00159         self.assertEqual(record.motifs[4].instances[11].tostring(), "CGACGCAGAGGAT")
00160         self.assertEqual(record.motifs[4].instances[12].tostring(), "ATGCTTAGAGGTT")
00161         self.assertEqual(record.motifs[4].instances[13].tostring(), "AGACTTGGGCGAT")
00162         self.assertEqual(record.motifs[4].instances[14].tostring(), "CGACCTGGAGGCT")
00163         self.assertEqual(record.motifs[4].mask, [1,1,0,1,0,1,1,1,1,1,1,0,1])
00164         self.assertAlmostEqual(record.motifs[4].score, 16.8287)
00165         self.assertEqual(record.motifs[5].alphabet, IUPAC.unambiguous_dna)
00166         self.assertEqual(len(record.motifs[5].instances), 18)
00167         self.assertEqual(record.motifs[5].instances[0].tostring(), "GTGCGCGAAGGAAGCAGCGCGTG")
00168         self.assertEqual(record.motifs[5].instances[1].tostring(), "TTGAGCCGAGTAAAGGGCTGGTG")
00169         self.assertEqual(record.motifs[5].instances[2].tostring(), "CAATGCTAAGCTCTGTGCCGACG")
00170         self.assertEqual(record.motifs[5].instances[3].tostring(), "CAACTCTCTATGTAGTGCCCGAG")
00171         self.assertEqual(record.motifs[5].instances[4].tostring(), "CGACGCTTTGTACCTGGCTTGCG")
00172         self.assertEqual(record.motifs[5].instances[5].tostring(), "CGAGTCAATGACACGCGCCTGGG")
00173         self.assertEqual(record.motifs[5].instances[6].tostring(), "CGATACGCTGCTAAGTGCCGTCC")
00174         self.assertEqual(record.motifs[5].instances[7].tostring(), "CCGGGCCAATAGCGGCGCCGGAG")
00175         self.assertEqual(record.motifs[5].instances[8].tostring(), "CCACGCTTCGACACGTGGTATAG")
00176         self.assertEqual(record.motifs[5].instances[9].tostring(), "CCGAGCCTCATGTACCGGAAGGG")
00177         self.assertEqual(record.motifs[5].instances[10].tostring(), "CTGCTCCCCGCATACAGCGCGTG")
00178         self.assertEqual(record.motifs[5].instances[11].tostring(), "CCGAGGTCCGGTACGGGCAAGCC")
00179         self.assertEqual(record.motifs[5].instances[12].tostring(), "GTGCTCATAGGGACGTCGCGGAG")
00180         self.assertEqual(record.motifs[5].instances[13].tostring(), "CCCTACTATGCGGGGGGCAGGTC")
00181         self.assertEqual(record.motifs[5].instances[14].tostring(), "GCCAGCAATTGCAGGTGGTCGTG")
00182         self.assertEqual(record.motifs[5].instances[15].tostring(), "CTCTGCGTCGCATGGCGGCGTGG")
00183         self.assertEqual(record.motifs[5].instances[16].tostring(), "GGAGGCTTAGACTTGGGCGATAC")
00184         self.assertEqual(record.motifs[5].instances[17].tostring(), "GCATGGAGAGAGATCCGGAGGAG")
00185         self.assertEqual(record.motifs[5].mask, [1,0,1,0,1,1,0,0,0,1,0,0,0,0,1,0,1,1,0,0,1,0,1])
00186         self.assertAlmostEqual(record.motifs[5].score, 15.0441)
00187         self.assertEqual(record.motifs[6].alphabet, IUPAC.unambiguous_dna)
00188         self.assertEqual(len(record.motifs[6].instances), 20)
00189         self.assertEqual(record.motifs[6].instances[0].tostring(), "GCGCGTGTGTGTAAC")
00190         self.assertEqual(record.motifs[6].instances[1].tostring(), "GCACAGAGCTTAGCA")
00191         self.assertEqual(record.motifs[6].instances[2].tostring(), "GGTGGTCATCGGGCA")
00192         self.assertEqual(record.motifs[6].instances[3].tostring(), "GCGCGTGTCATTGAC")
00193         self.assertEqual(record.motifs[6].instances[4].tostring(), "GGACGGCACTTAGCA")
00194         self.assertEqual(record.motifs[6].instances[5].tostring(), "GCGCGTCCCGGGCCA")
00195         self.assertEqual(record.motifs[6].instances[6].tostring(), "GCTCGGCCCGTTGTC")
00196         self.assertEqual(record.motifs[6].instances[7].tostring(), "GCGCGTGTCCTTTAA")
00197         self.assertEqual(record.motifs[6].instances[8].tostring(), "GCTGATCGCTGCTCC")
00198         self.assertEqual(record.motifs[6].instances[9].tostring(), "GCCCGTACCGGACCT")
00199         self.assertEqual(record.motifs[6].instances[10].tostring(), "GGACGTCGCGGAGGA")
00200         self.assertEqual(record.motifs[6].instances[11].tostring(), "GCGGGGGGCAGGTCA")
00201         self.assertEqual(record.motifs[6].instances[12].tostring(), "GGACGTACTGGCACA")
00202         self.assertEqual(record.motifs[6].instances[13].tostring(), "GCAGGTGGTCGTGCA")
00203         self.assertEqual(record.motifs[6].instances[14].tostring(), "GCGCATACCTTAACA")
00204         self.assertEqual(record.motifs[6].instances[15].tostring(), "GCACGGGACTTCAAC")
00205         self.assertEqual(record.motifs[6].instances[16].tostring(), "GCACGTAGCTGGTAA")
00206         self.assertEqual(record.motifs[6].instances[17].tostring(), "GCTCGTCTATGGTCA")
00207         self.assertEqual(record.motifs[6].instances[18].tostring(), "GCGCATGCTGGATCC")
00208         self.assertEqual(record.motifs[6].instances[19].tostring(), "GGCCGTCAGCTCTCA")
00209         self.assertEqual(record.motifs[6].mask, [1,1,0,1,1,1,1,0,1,0,1,0,0,1,1])
00210         self.assertAlmostEqual(record.motifs[6].score, 13.3145)
00211         self.assertEqual(record.motifs[7].alphabet, IUPAC.unambiguous_dna)
00212         self.assertEqual(len(record.motifs[7].instances), 20)
00213         self.assertEqual(record.motifs[7].instances[0].tostring(), "GAACCGAGGTCCGGTACGGGC")
00214         self.assertEqual(record.motifs[7].instances[1].tostring(), "GCCCCCCGCATAGTAGGGGGA")
00215         self.assertEqual(record.motifs[7].instances[2].tostring(), "GTCCCTGGGTAAGCTTGGGGC")
00216         self.assertEqual(record.motifs[7].instances[3].tostring(), "ACTCCACGCTTCGACACGTGG")
00217         self.assertEqual(record.motifs[7].instances[4].tostring(), "ATCCTCTGCGTCGCATGGCGG")
00218         self.assertEqual(record.motifs[7].instances[5].tostring(), "GTTCAATGCTAAGCTCTGTGC")
00219         self.assertEqual(record.motifs[7].instances[6].tostring(), "GCTCATAGGGACGTCGCGGAG")
00220         self.assertEqual(record.motifs[7].instances[7].tostring(), "GTCCCGGGCCAATAGCGGCGC")
00221         self.assertEqual(record.motifs[7].instances[8].tostring(), "GCACTTAGCAGCGTATCGTTA")
00222         self.assertEqual(record.motifs[7].instances[9].tostring(), "GGCCCTCGGATCGCTTGGGAA")
00223         self.assertEqual(record.motifs[7].instances[10].tostring(), "CTGCTGGACAACGGGCCGAGC")
00224         self.assertEqual(record.motifs[7].instances[11].tostring(), "GGGCACTACATAGAGAGTTGC")
00225         self.assertEqual(record.motifs[7].instances[12].tostring(), "AGCCTCCAGGTCGCATGGAGA")
00226         self.assertEqual(record.motifs[7].instances[13].tostring(), "AATCGTAGATCAGAGGCGAGA")
00227         self.assertEqual(record.motifs[7].instances[14].tostring(), "GAACTCCACTAAGACTTGAGA")
00228         self.assertEqual(record.motifs[7].instances[15].tostring(), "GAGCAGCGATCAGCTTGTGGG")
00229         self.assertEqual(record.motifs[7].instances[16].tostring(), "GCCAGGTACAAAGCGTCGTGC")
00230         self.assertEqual(record.motifs[7].instances[17].tostring(), "AGTCAATGACACGCGCCTGGG")
00231         self.assertEqual(record.motifs[7].instances[18].tostring(), "GGTCATGGAATCTTATGTAGC")
00232         self.assertEqual(record.motifs[7].instances[19].tostring(), "GTAGATAACAGAGGTCGGGGG")
00233         self.assertEqual(record.motifs[7].mask, [1,0,0,1,0,0,0,1,1,0,0,1,1,0,0,0,1,1,0,1,1])
00234         self.assertAlmostEqual(record.motifs[7].score, 11.6098)
00235         self.assertEqual(record.motifs[8].alphabet, IUPAC.unambiguous_dna)
00236         self.assertEqual(len(record.motifs[8].instances), 14)
00237         self.assertEqual(record.motifs[8].instances[0].tostring(), "CCGAGTAAAGGGCTG")
00238         self.assertEqual(record.motifs[8].instances[1].tostring(), "GTGGTCATCGGGCAC")
00239         self.assertEqual(record.motifs[8].instances[2].tostring(), "GATAACAGAGGTCGG")
00240         self.assertEqual(record.motifs[8].instances[3].tostring(), "CGGCGCCGGAGTCTG")
00241         self.assertEqual(record.motifs[8].instances[4].tostring(), "GCGCGTCCCGGGCCA")
00242         self.assertEqual(record.motifs[8].instances[5].tostring(), "CTGGACAACGGGCCG")
00243         self.assertEqual(record.motifs[8].instances[6].tostring(), "CGGATACTGGGGCAG")
00244         self.assertEqual(record.motifs[8].instances[7].tostring(), "GGGAGCAGCGATCAG")
00245         self.assertEqual(record.motifs[8].instances[8].tostring(), "CAGAACCGAGGTCCG")
00246         self.assertEqual(record.motifs[8].instances[9].tostring(), "GGGTCCCTGGGTAAG")
00247         self.assertEqual(record.motifs[8].instances[10].tostring(), "GTGCTCATAGGGACG")
00248         self.assertEqual(record.motifs[8].instances[11].tostring(), "GAGATCCGGAGGAGG")
00249         self.assertEqual(record.motifs[8].instances[12].tostring(), "GCGATCCGAGGGCCG")
00250         self.assertEqual(record.motifs[8].instances[13].tostring(), "GAGTTCACATGGCTG")
00251         self.assertEqual(record.motifs[8].mask, [1,0,1,0,0,1,1,0,1,1,1,1,1,0,1])
00252         self.assertAlmostEqual(record.motifs[8].score, 11.2943)
00253         self.assertEqual(record.motifs[9].alphabet, IUPAC.unambiguous_dna)
00254         self.assertEqual(len(record.motifs[9].instances), 18)
00255         self.assertEqual(record.motifs[9].instances[0].tostring(), "TAGAGGCGGTG")
00256         self.assertEqual(record.motifs[9].instances[1].tostring(), "GCTAAGCTCTG")
00257         self.assertEqual(record.motifs[9].instances[2].tostring(), "TGGAAGCAGTG")
00258         self.assertEqual(record.motifs[9].instances[3].tostring(), "GCGAGGCTGTG")
00259         self.assertEqual(record.motifs[9].instances[4].tostring(), "ACGACGCTTTG")
00260         self.assertEqual(record.motifs[9].instances[5].tostring(), "GGGACGCGCAC")
00261         self.assertEqual(record.motifs[9].instances[6].tostring(), "TCGAAGCGTGG")
00262         self.assertEqual(record.motifs[9].instances[7].tostring(), "TGTATGCGGGG")
00263         self.assertEqual(record.motifs[9].instances[8].tostring(), "GGTAAGCTTGG")
00264         self.assertEqual(record.motifs[9].instances[9].tostring(), "TGTACGCTGGG")
00265         self.assertEqual(record.motifs[9].instances[10].tostring(), "ACTATGCGGGG")
00266         self.assertEqual(record.motifs[9].instances[11].tostring(), "GGTATGCGCTG")
00267         self.assertEqual(record.motifs[9].instances[12].tostring(), "GGTACCCGGAG")
00268         self.assertEqual(record.motifs[9].instances[13].tostring(), "GCGACGCAGAG")
00269         self.assertEqual(record.motifs[9].instances[14].tostring(), "TGGCGGCGTGG")
00270         self.assertEqual(record.motifs[9].instances[15].tostring(), "TCTAGGCGGGC")
00271         self.assertEqual(record.motifs[9].instances[16].tostring(), "AGTATGCTTAG")
00272         self.assertEqual(record.motifs[9].instances[17].tostring(), "TGGAGGCTTAG")
00273         self.assertEqual(record.motifs[9].mask, [1,1,1,1,0,1,1,1,1,1,1])
00274         self.assertAlmostEqual(record.motifs[9].score, 9.7924)
00275         self.assertEqual(record.motifs[10].alphabet, IUPAC.unambiguous_dna)
00276         self.assertEqual(len(record.motifs[10].instances), 13)
00277         self.assertEqual(record.motifs[10].instances[0].tostring(), "GCACAGAGCTTAGCATTGAAC")
00278         self.assertEqual(record.motifs[10].instances[1].tostring(), "GTCCGCGGATTCCCAACATGC")
00279         self.assertEqual(record.motifs[10].instances[2].tostring(), "ATACACAGCCTCGCAAGCCAG")
00280         self.assertEqual(record.motifs[10].instances[3].tostring(), "GGCCCGGGACGCGCACTAAGA")
00281         self.assertEqual(record.motifs[10].instances[4].tostring(), "GCCCGTTGTCCAGCAGACGGC")
00282         self.assertEqual(record.motifs[10].instances[5].tostring(), "GAGCAGCGATCAGCTTGTGGG")
00283         self.assertEqual(record.motifs[10].instances[6].tostring(), "GAACCGAGGTCCGGTACGGGC")
00284         self.assertEqual(record.motifs[10].instances[7].tostring(), "GTCCCTGGGTAAGCTTGGGGC")
00285         self.assertEqual(record.motifs[10].instances[8].tostring(), "GACCTGCCCCCCGCATAGTAG")
00286         self.assertEqual(record.motifs[10].instances[9].tostring(), "AACCAGCGCATACCTTAACAG")
00287         self.assertEqual(record.motifs[10].instances[10].tostring(), "ATCCTCTGCGTCGCATGGCGG")
00288         self.assertEqual(record.motifs[10].instances[11].tostring(), "GACCATAGACGAGCATCAAAG")
00289         self.assertEqual(record.motifs[10].instances[12].tostring(), "GGCCCTCGGATCGCTTGGGAA")
00290         self.assertEqual(record.motifs[10].mask, [1,0,1,1,0,0,0,1,0,0,0,1,1,1,1,0,0,0,0,1,1])
00291         self.assertAlmostEqual(record.motifs[10].score, 9.01393)
00292         self.assertEqual(record.motifs[11].alphabet, IUPAC.unambiguous_dna)
00293         self.assertEqual(len(record.motifs[11].instances), 16)
00294         self.assertEqual(record.motifs[11].instances[0].tostring(), "GCCGTCCGTC")
00295         self.assertEqual(record.motifs[11].instances[1].tostring(), "GGCGTGCGCG")
00296         self.assertEqual(record.motifs[11].instances[2].tostring(), "GGCGCGTGTC")
00297         self.assertEqual(record.motifs[11].instances[3].tostring(), "AGCGCGTGTG")
00298         self.assertEqual(record.motifs[11].instances[4].tostring(), "GCGGTGCGTG")
00299         self.assertEqual(record.motifs[11].instances[5].tostring(), "AGCGCGTGTC")
00300         self.assertEqual(record.motifs[11].instances[6].tostring(), "AGCGTCCGCG")
00301         self.assertEqual(record.motifs[11].instances[7].tostring(), "ACCGTCTGTG")
00302         self.assertEqual(record.motifs[11].instances[8].tostring(), "GCCATGCGAC")
00303         self.assertEqual(record.motifs[11].instances[9].tostring(), "ACCACCCGTC")
00304         self.assertEqual(record.motifs[11].instances[10].tostring(), "GGCGCCGGAG")
00305         self.assertEqual(record.motifs[11].instances[11].tostring(), "ACCACGTGTC")
00306         self.assertEqual(record.motifs[11].instances[12].tostring(), "GGCTTGCGAG")
00307         self.assertEqual(record.motifs[11].instances[13].tostring(), "GCGATCCGAG")
00308         self.assertEqual(record.motifs[11].instances[14].tostring(), "AGTGCGCGTC")
00309         self.assertEqual(record.motifs[11].instances[15].tostring(), "AGTGCCCGAG")
00310         self.assertEqual(record.motifs[11].mask, [1,1,1,1,1,1,1,1,1,1])
00311         self.assertAlmostEqual(record.motifs[11].score, 7.51121)
00312         self.assertEqual(record.motifs[12].alphabet, IUPAC.unambiguous_dna)
00313         self.assertEqual(len(record.motifs[12].instances), 16)
00314         self.assertEqual(record.motifs[12].instances[0].tostring(), "GCCGACGGGTGGTCATCGGG")
00315         self.assertEqual(record.motifs[12].instances[1].tostring(), "GCACGACGCTTTGTACCTGG")
00316         self.assertEqual(record.motifs[12].instances[2].tostring(), "CCTGGGAGGGTTCAATAACG")
00317         self.assertEqual(record.motifs[12].instances[3].tostring(), "GCGCGTCCCGGGCCAATAGC")
00318         self.assertEqual(record.motifs[12].instances[4].tostring(), "GCCGTCTGCTGGACAACGGG")
00319         self.assertEqual(record.motifs[12].instances[5].tostring(), "GTCCCTTCCGGTACATGAGG")
00320         self.assertEqual(record.motifs[12].instances[6].tostring(), "GCTGCTCCCCGCATACAGCG")
00321         self.assertEqual(record.motifs[12].instances[7].tostring(), "GCCCCAAGCTTACCCAGGGA")
00322         self.assertEqual(record.motifs[12].instances[8].tostring(), "ACCGGCTGACGCTAATACGG")
00323         self.assertEqual(record.motifs[12].instances[9].tostring(), "GCGGGGGGCAGGTCATTACA")
00324         self.assertEqual(record.motifs[12].instances[10].tostring(), "GCTGGCAGCGTCTAAGAAGG")
00325         self.assertEqual(record.motifs[12].instances[11].tostring(), "GCAGGTGGTCGTGCAATACG")
00326         self.assertEqual(record.motifs[12].instances[12].tostring(), "GCTGGTTGAAGTCCCGTGCG")
00327         self.assertEqual(record.motifs[12].instances[13].tostring(), "GCACGTAGCTGGTAAATAGG")
00328         self.assertEqual(record.motifs[12].instances[14].tostring(), "GCGGCGTGGATTTCATACAG")
00329         self.assertEqual(record.motifs[12].instances[15].tostring(), "CCTGGAGGCTTAGACTTGGG")
00330         self.assertEqual(record.motifs[12].mask, [1,1,0,1,1,0,0,1,1,0,1,0,0,0,1,0,0,0,1,1])
00331         self.assertAlmostEqual(record.motifs[12].score, 5.63667)
00332         self.assertEqual(record.motifs[13].alphabet, IUPAC.unambiguous_dna)
00333         self.assertEqual(len(record.motifs[13].instances), 15)
00334         self.assertEqual(record.motifs[13].instances[0].tostring(), "GCCGACGGGTGGTCATCGGG")
00335         self.assertEqual(record.motifs[13].instances[1].tostring(), "ATCCGCGGACGCTTAGAGGG")
00336         self.assertEqual(record.motifs[13].instances[2].tostring(), "ACGCTTTGTACCTGGCTTGC")
00337         self.assertEqual(record.motifs[13].instances[3].tostring(), "ACGGACGGCACTTAGCAGCG")
00338         self.assertEqual(record.motifs[13].instances[4].tostring(), "GCCGTCTGCTGGACAACGGG")
00339         self.assertEqual(record.motifs[13].instances[5].tostring(), "ACACACAGACGGTTGAAAGG")
00340         self.assertEqual(record.motifs[13].instances[6].tostring(), "GCCGATAGTGCTTAAGTTCG")
00341         self.assertEqual(record.motifs[13].instances[7].tostring(), "CTTGCCCGTACCGGACCTCG")
00342         self.assertEqual(record.motifs[13].instances[8].tostring(), "ACCGGCTGACGCTAATACGG")
00343         self.assertEqual(record.motifs[13].instances[9].tostring(), "GCCCCCCGCATAGTAGGGGG")
00344         self.assertEqual(record.motifs[13].instances[10].tostring(), "GCTGGCAGCGTCTAAGAAGG")
00345         self.assertEqual(record.motifs[13].instances[11].tostring(), "GCAGGTGGTCGTGCAATACG")
00346         self.assertEqual(record.motifs[13].instances[12].tostring(), "ACGCACGGGACTTCAACCAG")
00347         self.assertEqual(record.motifs[13].instances[13].tostring(), "GCACGTAGCTGGTAAATAGG")
00348         self.assertEqual(record.motifs[13].instances[14].tostring(), "ATCCTCTGCGTCGCATGGCG")
00349         self.assertEqual(record.motifs[13].mask, [1,1,0,1,0,1,0,1,0,0,1,0,1,0,1,0,0,0,1,1])
00350         self.assertAlmostEqual(record.motifs[13].score, 3.89842)
00351         self.assertEqual(record.motifs[14].alphabet, IUPAC.unambiguous_dna)
00352         self.assertEqual(len(record.motifs[14].instances), 14)
00353         self.assertEqual(record.motifs[14].instances[0].tostring(), "GAGGCTGTGTAT")
00354         self.assertEqual(record.motifs[14].instances[1].tostring(), "GAGGTCGGGGGT")
00355         self.assertEqual(record.motifs[14].instances[2].tostring(), "GACGGACGGCAC")
00356         self.assertEqual(record.motifs[14].instances[3].tostring(), "TTGGCCCGGGAC")
00357         self.assertEqual(record.motifs[14].instances[4].tostring(), "GAGGCTCGGCCC")
00358         self.assertEqual(record.motifs[14].instances[5].tostring(), "CACGCGCTGTAT")
00359         self.assertEqual(record.motifs[14].instances[6].tostring(), "TAGGCCAGGTAT")
00360         self.assertEqual(record.motifs[14].instances[7].tostring(), "GAGGTCCGGTAC")
00361         self.assertEqual(record.motifs[14].instances[8].tostring(), "TACGCTGGGGAT")
00362         self.assertEqual(record.motifs[14].instances[9].tostring(), "GTCGCGGAGGAT")
00363         self.assertEqual(record.motifs[14].instances[10].tostring(), "TACGCACGGGAC")
00364         self.assertEqual(record.motifs[14].instances[11].tostring(), "TACTCCGGGTAC")
00365         self.assertEqual(record.motifs[14].instances[12].tostring(), "GACGCAGAGGAT")
00366         self.assertEqual(record.motifs[14].instances[13].tostring(), "TAGGCGGGCCAT")
00367         self.assertEqual(record.motifs[14].mask, [1,1,1,1,1,0,1,1,1,0,1,1])
00368         self.assertAlmostEqual(record.motifs[14].score, 3.33444)
00369         self.assertEqual(record.motifs[15].alphabet, IUPAC.unambiguous_dna)
00370         self.assertEqual(len(record.motifs[15].instances), 21)
00371         self.assertEqual(record.motifs[15].instances[0].tostring(), "CGGCTCAATCGTAGAGGC")
00372         self.assertEqual(record.motifs[15].instances[1].tostring(), "CGACGGGTGGTCATCGGG")
00373         self.assertEqual(record.motifs[15].instances[2].tostring(), "CGCTTAGAGGGCACAAGC")
00374         self.assertEqual(record.motifs[15].instances[3].tostring(), "TGACACGCGCCTGGGAGG")
00375         self.assertEqual(record.motifs[15].instances[4].tostring(), "CGATACGCTGCTAAGTGC")
00376         self.assertEqual(record.motifs[15].instances[5].tostring(), "CGTCCCGGGCCAATAGCG")
00377         self.assertEqual(record.motifs[15].instances[6].tostring(), "CCACGCTTCGACACGTGG")
00378         self.assertEqual(record.motifs[15].instances[7].tostring(), "CGTCTGCTGGACAACGGG")
00379         self.assertEqual(record.motifs[15].instances[8].tostring(), "ACACAGACGGTTGAAAGG")
00380         self.assertEqual(record.motifs[15].instances[9].tostring(), "TGCTCCCCGCATACAGCG")
00381         self.assertEqual(record.motifs[15].instances[10].tostring(), "TGAGGCTTGCCCGTACCG")
00382         self.assertEqual(record.motifs[15].instances[11].tostring(), "TGCCCCAAGCTTACCCAG")
00383         self.assertEqual(record.motifs[15].instances[12].tostring(), "CGGCTGACGCTAATACGG")
00384         self.assertEqual(record.motifs[15].instances[13].tostring(), "CGCGACGTCCCTATGAGC")
00385         self.assertEqual(record.motifs[15].instances[14].tostring(), "TGCCCCCCGCATAGTAGG")
00386         self.assertEqual(record.motifs[15].instances[15].tostring(), "CGTTGCCTTCTTAGACGC")
00387         self.assertEqual(record.motifs[15].instances[16].tostring(), "TGACTCAATCGTAGACCC")
00388         self.assertEqual(record.motifs[15].instances[17].tostring(), "AGTCCCGTGCGTATGTGG")
00389         self.assertEqual(record.motifs[15].instances[18].tostring(), "AGGCTCGCACGTAGCTGG")
00390         self.assertEqual(record.motifs[15].instances[19].tostring(), "CCACGCCGCCATGCGACG")
00391         self.assertEqual(record.motifs[15].instances[20].tostring(), "AGCCTCCAGGTCGCATGG")
00392         self.assertEqual(record.motifs[15].mask, [1,1,0,1,0,1,0,0,1,1,0,1,1,0,0,0,1,1])
00393         self.assertAlmostEqual(record.motifs[15].score, 1.0395)
00395     def test_pfm_parsing(self):
00396         """Test to be sure that Motif can parse pfm  files.
00397         """
00398         motif=,"jaspar-pfm")
00399         assert motif.length==12
00401     def test_sites_parsing(self):
00402         """Test to be sure that Motif can parse sites files.
00403         """
00404         motif=,"jaspar-sites")
00405         assert motif.length==6
00407     def test_FAoutput(self):
00408         """Ensure that we can write proper FASTA output files.
00409         """
00410         output_handle = open(self.FAout, "w")
00411         output_handle.write(self.m.format("fasta"))
00412         output_handle.close()
00414     def test_TFoutput(self):
00415         """Ensure that we can write proper TransFac output files.
00416         """
00417         output_handle = open(self.TFout, "w")
00418         output_handle.write(self.m.format("transfac"))
00419         output_handle.close()
00421     def test_pfm_output(self):
00422         """Ensure that we can write proper pfm output files.
00423         """
00424         output_handle = open(self.PFMout, "w")
00425         output_handle.write(self.m.format("jaspar-pfm"))
00426         output_handle.close()
00429 class TestMEME(unittest.TestCase):
00431     def test_meme_parser_1(self):
00432         """Test if Motif can parse MEME output files (first test)
00433         """
00434         from Bio.Alphabet import IUPAC
00435         from Bio.Motif.Parsers import MEME
00436         handle = open("Motif/meme.out")
00437         record =
00438         self.assertEqual(record.version, '3.5.7')
00439         self.assertEqual(record.datafile, 'test.fa')
00440         self.assertEqual(record.alphabet, IUPAC.unambiguous_dna)
00441         self.assertEqual(len(record.sequence_names), 10)
00442         self.assertEqual(record.sequence_names[0], 'SEQ1;')
00443         self.assertEqual(record.sequence_names[1], 'SEQ2;')
00444         self.assertEqual(record.sequence_names[2], 'SEQ3;')
00445         self.assertEqual(record.sequence_names[3], 'SEQ4;')
00446         self.assertEqual(record.sequence_names[4], 'SEQ5;')
00447         self.assertEqual(record.sequence_names[5], 'SEQ6;')
00448         self.assertEqual(record.sequence_names[6], 'SEQ7;')
00449         self.assertEqual(record.sequence_names[7], 'SEQ8;')
00450         self.assertEqual(record.sequence_names[8], 'SEQ9;')
00451         self.assertEqual(record.sequence_names[9], 'SEQ10;')
00452         self.assertEqual(record.command, 'meme test.fa -dna -w 10 -dir /home/bartek/MetaMotif/meme')
00453         self.assertEqual(len(record.motifs), 1)
00454         motif = record.motifs[0]
00455         self.assertEqual(motif.num_occurrences, 10)
00456         self.assertAlmostEqual(motif.evalue, 1.1e-22)
00457         self.assertEqual(motif.alphabet, IUPAC.unambiguous_dna)
00458         self.assertEqual(, "Motif 1")
00459         self.assertEqual(len(motif.instances), 10)
00460         self.assertAlmostEqual(motif.instances[0].pvalue, 8.71e-07)
00461         self.assertAlmostEqual(motif.instances[1].pvalue, 8.71e-07)
00462         self.assertAlmostEqual(motif.instances[2].pvalue, 8.71e-07)
00463         self.assertAlmostEqual(motif.instances[3].pvalue, 8.71e-07)
00464         self.assertAlmostEqual(motif.instances[4].pvalue, 8.71e-07)
00465         self.assertAlmostEqual(motif.instances[5].pvalue, 8.71e-07)
00466         self.assertAlmostEqual(motif.instances[6].pvalue, 8.71e-07)
00467         self.assertAlmostEqual(motif.instances[7].pvalue, 8.71e-07)
00468         self.assertAlmostEqual(motif.instances[8].pvalue, 8.71e-07)
00469         self.assertAlmostEqual(motif.instances[9].pvalue, 8.71e-07)
00470         self.assertEqual(motif.instances[0].sequence_name, 'SEQ10;')
00471         self.assertEqual(motif.instances[1].sequence_name, 'SEQ9;')
00472         self.assertEqual(motif.instances[2].sequence_name, 'SEQ8;')
00473         self.assertEqual(motif.instances[3].sequence_name, 'SEQ7;')
00474         self.assertEqual(motif.instances[4].sequence_name, 'SEQ6;')
00475         self.assertEqual(motif.instances[5].sequence_name, 'SEQ5;')
00476         self.assertEqual(motif.instances[6].sequence_name, 'SEQ4;')
00477         self.assertEqual(motif.instances[7].sequence_name, 'SEQ3;')
00478         self.assertEqual(motif.instances[8].sequence_name, 'SEQ2;')
00479         self.assertEqual(motif.instances[9].sequence_name, 'SEQ1;')
00480         self.assertEqual(motif.instances[0].start, 3)
00481         self.assertEqual(motif.instances[1].start, 93)
00482         self.assertEqual(motif.instances[2].start, 172)
00483         self.assertEqual(motif.instances[3].start, 177)
00484         self.assertEqual(motif.instances[4].start, 105)
00485         self.assertEqual(motif.instances[5].start, 185)
00486         self.assertEqual(motif.instances[6].start, 173)
00487         self.assertEqual(motif.instances[7].start, 112)
00488         self.assertEqual(motif.instances[8].start, 172)
00489         self.assertEqual(motif.instances[9].start, 52)
00490         self.assertEqual(motif.instances[0].strand, '+')
00491         self.assertEqual(motif.instances[1].strand, '+')
00492         self.assertEqual(motif.instances[2].strand, '+')
00493         self.assertEqual(motif.instances[3].strand, '+')
00494         self.assertEqual(motif.instances[4].strand, '+')
00495         self.assertEqual(motif.instances[5].strand, '+')
00496         self.assertEqual(motif.instances[6].strand, '+')
00497         self.assertEqual(motif.instances[7].strand, '+')
00498         self.assertEqual(motif.instances[8].strand, '+')
00499         self.assertEqual(motif.instances[9].strand, '+')
00500         self.assertEqual(motif.instances[0].length, 10)
00501         self.assertEqual(motif.instances[1].length, 10)
00502         self.assertEqual(motif.instances[2].length, 10)
00503         self.assertEqual(motif.instances[3].length, 10)
00504         self.assertEqual(motif.instances[4].length, 10)
00505         self.assertEqual(motif.instances[5].length, 10)
00506         self.assertEqual(motif.instances[6].length, 10)
00507         self.assertEqual(motif.instances[7].length, 10)
00508         self.assertEqual(motif.instances[8].length, 10)
00509         self.assertEqual(motif.instances[9].length, 10)
00510         self.assertEqual(motif.instances[0].motif_name, 'Motif 1')
00511         self.assertEqual(motif.instances[1].motif_name, 'Motif 1')
00512         self.assertEqual(motif.instances[2].motif_name, 'Motif 1')
00513         self.assertEqual(motif.instances[3].motif_name, 'Motif 1')
00514         self.assertEqual(motif.instances[4].motif_name, 'Motif 1')
00515         self.assertEqual(motif.instances[5].motif_name, 'Motif 1')
00516         self.assertEqual(motif.instances[6].motif_name, 'Motif 1')
00517         self.assertEqual(motif.instances[7].motif_name, 'Motif 1')
00518         self.assertEqual(motif.instances[8].motif_name, 'Motif 1')
00519         self.assertEqual(motif.instances[9].motif_name, 'Motif 1')
00520         self.assertEqual(motif.instances[0].alphabet, IUPAC.unambiguous_dna)
00521         self.assertEqual(motif.instances[1].alphabet, IUPAC.unambiguous_dna)
00522         self.assertEqual(motif.instances[2].alphabet, IUPAC.unambiguous_dna)
00523         self.assertEqual(motif.instances[3].alphabet, IUPAC.unambiguous_dna)
00524         self.assertEqual(motif.instances[4].alphabet, IUPAC.unambiguous_dna)
00525         self.assertEqual(motif.instances[5].alphabet, IUPAC.unambiguous_dna)
00526         self.assertEqual(motif.instances[6].alphabet, IUPAC.unambiguous_dna)
00527         self.assertEqual(motif.instances[7].alphabet, IUPAC.unambiguous_dna)
00528         self.assertEqual(motif.instances[8].alphabet, IUPAC.unambiguous_dna)
00529         self.assertEqual(motif.instances[9].alphabet, IUPAC.unambiguous_dna)
00530         self.assertEqual(motif.instances[0].tostring(), "CTCAATCGTA")
00531         self.assertEqual(motif.instances[1].tostring(), "CTCAATCGTA")
00532         self.assertEqual(motif.instances[2].tostring(), "CTCAATCGTA")
00533         self.assertEqual(motif.instances[3].tostring(), "CTCAATCGTA")
00534         self.assertEqual(motif.instances[4].tostring(), "CTCAATCGTA")
00535         self.assertEqual(motif.instances[5].tostring(), "CTCAATCGTA")
00536         self.assertEqual(motif.instances[6].tostring(), "CTCAATCGTA")
00537         self.assertEqual(motif.instances[7].tostring(), "CTCAATCGTA")
00538         self.assertEqual(motif.instances[8].tostring(), "CTCAATCGTA")
00539         self.assertEqual(motif.instances[9].tostring(), "CTCAATCGTA")
00540         handle.close()
00542     def test_meme_parser_2(self):
00543         """Test if Motif can parse MEME output files (second test)
00544         """
00545         from Bio.Alphabet import IUPAC
00546         from Bio.Motif.Parsers import MEME
00547         handle = open("Motif/meme.dna.oops.txt")
00548         record =
00549         self.assertEqual(record.version, '3.0')
00550         self.assertEqual(record.datafile, 'INO_up800.s')
00551         self.assertEqual(record.alphabet, IUPAC.unambiguous_dna)
00552         self.assertEqual(len(record.sequence_names), 7)
00553         self.assertEqual(record.sequence_names[0], 'CHO1')
00554         self.assertEqual(record.sequence_names[1], 'CHO2')
00555         self.assertEqual(record.sequence_names[2], 'FAS1')
00556         self.assertEqual(record.sequence_names[3], 'FAS2')
00557         self.assertEqual(record.sequence_names[4], 'ACC1')
00558         self.assertEqual(record.sequence_names[5], 'INO1')
00559         self.assertEqual(record.sequence_names[6], 'OPI3')
00560         self.assertEqual(record.command, 'meme -mod oops -dna -revcomp -nmotifs 2 -bfile INO_up800.s')
00561         self.assertEqual(len(record.motifs), 2)
00562         motif = record.motifs[0]
00563         self.assertEqual(motif.num_occurrences, 7)
00564         self.assertAlmostEqual(motif.evalue, 0.2)
00565         self.assertEqual(motif.alphabet, IUPAC.unambiguous_dna)
00566         self.assertEqual(, "Motif 1")
00567         self.assertEqual(len(motif.instances), 7)
00568         self.assertAlmostEqual(motif.instances[0].pvalue, 1.85e-08)
00569         self.assertAlmostEqual(motif.instances[1].pvalue, 1.85e-08)
00570         self.assertAlmostEqual(motif.instances[2].pvalue, 1.52e-07)
00571         self.assertAlmostEqual(motif.instances[3].pvalue, 2.52e-07)
00572         self.assertAlmostEqual(motif.instances[4].pvalue, 4.23e-07)
00573         self.assertAlmostEqual(motif.instances[5].pvalue, 9.43e-07)
00574         self.assertAlmostEqual(motif.instances[6].pvalue, 3.32e-06)
00575         self.assertEqual(motif.instances[0].sequence_name, 'INO1')
00576         self.assertEqual(motif.instances[1].sequence_name, 'FAS1')
00577         self.assertEqual(motif.instances[2].sequence_name, 'ACC1')
00578         self.assertEqual(motif.instances[3].sequence_name, 'CHO2')
00579         self.assertEqual(motif.instances[4].sequence_name, 'CHO1')
00580         self.assertEqual(motif.instances[5].sequence_name, 'FAS2')
00581         self.assertEqual(motif.instances[6].sequence_name, 'OPI3')
00582         self.assertEqual(motif.instances[0].strand, '-')
00583         self.assertEqual(motif.instances[1].strand, '+')
00584         self.assertEqual(motif.instances[2].strand, '+')
00585         self.assertEqual(motif.instances[3].strand, '+')
00586         self.assertEqual(motif.instances[4].strand, '+')
00587         self.assertEqual(motif.instances[5].strand, '+')
00588         self.assertEqual(motif.instances[6].strand, '+')
00589         self.assertEqual(motif.instances[0].length, 12)
00590         self.assertEqual(motif.instances[1].length, 12)
00591         self.assertEqual(motif.instances[2].length, 12)
00592         self.assertEqual(motif.instances[3].length, 12)
00593         self.assertEqual(motif.instances[4].length, 12)
00594         self.assertEqual(motif.instances[5].length, 12)
00595         self.assertEqual(motif.instances[6].length, 12)
00596         self.assertEqual(motif.instances[0].start, 620)
00597         self.assertEqual(motif.instances[1].start,  95)
00598         self.assertEqual(motif.instances[2].start,  83)
00599         self.assertEqual(motif.instances[3].start, 354)
00600         self.assertEqual(motif.instances[4].start, 611)
00601         self.assertEqual(motif.instances[5].start, 567)
00602         self.assertEqual(motif.instances[6].start, 340)
00603         self.assertEqual(motif.instances[0].tostring(), "TTCACATGCCGC")
00604         self.assertEqual(motif.instances[1].tostring(), "TTCACATGCCGC")
00605         self.assertEqual(motif.instances[2].tostring(), "TTCACATGGCCC")
00606         self.assertEqual(motif.instances[3].tostring(), "TTCTCATGCCGC")
00607         self.assertEqual(motif.instances[4].tostring(), "TTCACACGGCAC")
00608         self.assertEqual(motif.instances[5].tostring(), "TTCACATGCTAC")
00609         self.assertEqual(motif.instances[6].tostring(), "TTCAGATCGCTC")
00610         motif = record.motifs[1]
00611         self.assertEqual(motif.num_occurrences, 7)
00612         self.assertAlmostEqual(motif.evalue, 110)
00613         self.assertEqual(motif.alphabet, IUPAC.unambiguous_dna)
00614         self.assertEqual(, "Motif 2")
00615         self.assertEqual(len(motif.instances), 7)
00616         self.assertAlmostEqual(motif.instances[0].pvalue, 3.24e-07)
00617         self.assertAlmostEqual(motif.instances[1].pvalue, 3.24e-07)
00618         self.assertAlmostEqual(motif.instances[2].pvalue, 3.24e-07)
00619         self.assertAlmostEqual(motif.instances[3].pvalue, 5.29e-06)
00620         self.assertAlmostEqual(motif.instances[4].pvalue, 6.25e-06)
00621         self.assertAlmostEqual(motif.instances[5].pvalue, 8.48e-06)
00622         self.assertAlmostEqual(motif.instances[6].pvalue, 8.48e-06)
00623         self.assertEqual(motif.instances[0].sequence_name, 'OPI3')
00624         self.assertEqual(motif.instances[1].sequence_name, 'ACC1')
00625         self.assertEqual(motif.instances[2].sequence_name, 'CHO1')
00626         self.assertEqual(motif.instances[3].sequence_name, 'INO1')
00627         self.assertEqual(motif.instances[4].sequence_name, 'FAS1')
00628         self.assertEqual(motif.instances[5].sequence_name, 'FAS2')
00629         self.assertEqual(motif.instances[6].sequence_name, 'CHO2')
00630         self.assertEqual(motif.instances[0].strand, '-')
00631         self.assertEqual(motif.instances[1].strand, '+')
00632         self.assertEqual(motif.instances[2].strand, '-')
00633         self.assertEqual(motif.instances[3].strand, '-')
00634         self.assertEqual(motif.instances[4].strand, '+')
00635         self.assertEqual(motif.instances[5].strand, '-')
00636         self.assertEqual(motif.instances[6].strand, '-')
00637         self.assertEqual(motif.instances[0].length, 10)
00638         self.assertEqual(motif.instances[1].length, 10)
00639         self.assertEqual(motif.instances[2].length, 10)
00640         self.assertEqual(motif.instances[3].length, 10)
00641         self.assertEqual(motif.instances[4].length, 10)
00642         self.assertEqual(motif.instances[5].length, 10)
00643         self.assertEqual(motif.instances[6].length, 10)
00644         self.assertEqual(motif.instances[0].start, 186)
00645         self.assertEqual(motif.instances[1].start, 232)
00646         self.assertEqual(motif.instances[2].start, 559)
00647         self.assertEqual(motif.instances[3].start, 283)
00648         self.assertEqual(motif.instances[4].start,  44)
00649         self.assertEqual(motif.instances[5].start, 185)
00650         self.assertEqual(motif.instances[6].start, 413)
00651         self.assertEqual(motif.instances[0].tostring(), "TCTGGCACAG")
00652         self.assertEqual(motif.instances[1].tostring(), "TCTGGCACAG")
00653         self.assertEqual(motif.instances[2].tostring(), "TCTGGCACAG")
00654         self.assertEqual(motif.instances[3].tostring(), "GCGGGCGCAG")
00655         self.assertEqual(motif.instances[4].tostring(), "GCAGGCACGG")
00656         self.assertEqual(motif.instances[5].tostring(), "TCTGGCACTC")
00657         self.assertEqual(motif.instances[6].tostring(), "TCTGGCATCG")
00658         handle.close()
00660     def test_meme_parser_3(self):
00661         """Test if Motif can parse MEME output files (third test)
00662         """
00663         from Bio.Alphabet import IUPAC
00664         from Bio.Motif.Parsers import MEME
00665         handle = open("Motif/meme.protein.oops.txt")
00666         record =
00667         self.assertEqual(record.version, '3.0')
00668         self.assertEqual(record.datafile, 'adh.s')
00669         self.assertEqual(record.alphabet, IUPAC.protein)
00670         self.assertEqual(len(record.sequence_names), 33)
00671         self.assertEqual(record.sequence_names[0], "2BHD_STREX")
00672         self.assertEqual(record.sequence_names[1], "3BHD_COMTE")
00673         self.assertEqual(record.sequence_names[2], "ADH_DROME")
00674         self.assertEqual(record.sequence_names[3], "AP27_MOUSE")
00675         self.assertEqual(record.sequence_names[4], "BA72_EUBSP")
00676         self.assertEqual(record.sequence_names[5], "BDH_HUMAN")
00677         self.assertEqual(record.sequence_names[6], "BPHB_PSEPS")
00678         self.assertEqual(record.sequence_names[7], "BUDC_KLETE")
00679         self.assertEqual(record.sequence_names[8], "DHES_HUMAN")
00680         self.assertEqual(record.sequence_names[9], "DHGB_BACME")
00681         self.assertEqual(record.sequence_names[10], "DHII_HUMAN")
00682         self.assertEqual(record.sequence_names[11], "DHMA_FLAS1")
00683         self.assertEqual(record.sequence_names[12], "ENTA_ECOLI")
00684         self.assertEqual(record.sequence_names[13], "FIXR_BRAJA")
00685         self.assertEqual(record.sequence_names[14], "GUTD_ECOLI")
00686         self.assertEqual(record.sequence_names[15], "HDE_CANTR")
00687         self.assertEqual(record.sequence_names[16], "HDHA_ECOLI")
00688         self.assertEqual(record.sequence_names[17], "LIGD_PSEPA")
00689         self.assertEqual(record.sequence_names[18], "NODG_RHIME")
00690         self.assertEqual(record.sequence_names[19], "RIDH_KLEAE")
00691         self.assertEqual(record.sequence_names[20], "YINL_LISMO")
00692         self.assertEqual(record.sequence_names[21], "YRTP_BACSU")
00693         self.assertEqual(record.sequence_names[22], "CSGA_MYXXA")
00694         self.assertEqual(record.sequence_names[23], "DHB2_HUMAN")
00695         self.assertEqual(record.sequence_names[24], "DHB3_HUMAN")
00696         self.assertEqual(record.sequence_names[25], "DHCA_HUMAN")
00697         self.assertEqual(record.sequence_names[26], "FABI_ECOLI")
00698         self.assertEqual(record.sequence_names[27], "FVT1_HUMAN")
00699         self.assertEqual(record.sequence_names[28], "HMTR_LEIMA")
00700         self.assertEqual(record.sequence_names[29], "MAS1_AGRRA")
00701         self.assertEqual(record.sequence_names[30], "PCR_PEA")
00702         self.assertEqual(record.sequence_names[31], "RFBB_NEIGO")
00703         self.assertEqual(record.sequence_names[32], "YURA_MYXXA")
00704         self.assertEqual(record.command, 'meme adh.s -mod oops -protein -nmotifs 2')
00705         self.assertEqual(len(record.motifs), 2)
00706         motif = record.motifs[0]
00707         self.assertEqual(motif.num_occurrences, 33)
00708         self.assertAlmostEqual(motif.evalue, 3.6e-165)
00709         self.assertEqual(motif.alphabet, IUPAC.protein)
00710         self.assertEqual(, "Motif 1")
00711         self.assertEqual(len(motif.instances), 33)
00712         self.assertAlmostEqual(motif.instances[0].pvalue, 1.64e-22)
00713         self.assertAlmostEqual(motif.instances[1].pvalue, 6.32e-22)
00714         self.assertAlmostEqual(motif.instances[2].pvalue, 1.13e-21)
00715         self.assertAlmostEqual(motif.instances[3].pvalue, 4.04e-21)
00716         self.assertAlmostEqual(motif.instances[4].pvalue, 6.12e-21)
00717         self.assertAlmostEqual(motif.instances[5].pvalue, 7.52e-20)
00718         self.assertAlmostEqual(motif.instances[6].pvalue, 3.35e-19)
00719         self.assertAlmostEqual(motif.instances[7].pvalue, 4.82e-19)
00720         self.assertAlmostEqual(motif.instances[8].pvalue, 4.82e-19)
00721         self.assertAlmostEqual(motif.instances[9].pvalue, 1.11e-18)
00722         self.assertAlmostEqual(motif.instances[10].pvalue, 1.25e-18)
00723         self.assertAlmostEqual(motif.instances[11].pvalue, 2.23e-18)
00724         self.assertAlmostEqual(motif.instances[12].pvalue, 5.53e-18)
00725         self.assertAlmostEqual(motif.instances[13].pvalue, 9.65e-18)
00726         self.assertAlmostEqual(motif.instances[14].pvalue, 2.86e-17)
00727         self.assertAlmostEqual(motif.instances[15].pvalue, 8.20e-17)
00728         self.assertAlmostEqual(motif.instances[16].pvalue, 9.09e-17)
00729         self.assertAlmostEqual(motif.instances[17].pvalue, 1.37e-16)
00730         self.assertAlmostEqual(motif.instances[18].pvalue, 2.52e-16)
00731         self.assertAlmostEqual(motif.instances[19].pvalue, 1.21e-15)
00732         self.assertAlmostEqual(motif.instances[20].pvalue, 1.61e-15)
00733         self.assertAlmostEqual(motif.instances[21].pvalue, 1.77e-15)
00734         self.assertAlmostEqual(motif.instances[22].pvalue, 7.81e-15)
00735         self.assertAlmostEqual(motif.instances[23].pvalue, 8.55e-15)
00736         self.assertAlmostEqual(motif.instances[24].pvalue, 1.47e-14)
00737         self.assertAlmostEqual(motif.instances[25].pvalue, 3.24e-14)
00738         self.assertAlmostEqual(motif.instances[26].pvalue, 1.80e-12)
00739         self.assertAlmostEqual(motif.instances[27].pvalue, 2.10e-12)
00740         self.assertAlmostEqual(motif.instances[28].pvalue, 4.15e-12)
00741         self.assertAlmostEqual(motif.instances[29].pvalue, 5.20e-12)
00742         self.assertAlmostEqual(motif.instances[30].pvalue, 4.80e-10)
00743         self.assertAlmostEqual(motif.instances[31].pvalue, 2.77e-08)
00744         self.assertAlmostEqual(motif.instances[32].pvalue, 5.72e-08)
00745         self.assertEqual(motif.instances[0].sequence_name, 'YRTP_BACSU')
00746         self.assertEqual(motif.instances[1].sequence_name, 'AP27_MOUSE')
00747         self.assertEqual(motif.instances[2].sequence_name, 'NODG_RHIME')
00748         self.assertEqual(motif.instances[3].sequence_name, 'BUDC_KLETE')
00749         self.assertEqual(motif.instances[4].sequence_name, 'FIXR_BRAJA')
00750         self.assertEqual(motif.instances[5].sequence_name, 'DHGB_BACME')
00751         self.assertEqual(motif.instances[6].sequence_name, 'HMTR_LEIMA')
00752         self.assertEqual(motif.instances[7].sequence_name, 'YURA_MYXXA')
00753         self.assertEqual(motif.instances[8].sequence_name, 'GUTD_ECOLI')
00754         self.assertEqual(motif.instances[9].sequence_name, '2BHD_STREX')
00755         self.assertEqual(motif.instances[10].sequence_name, 'HDHA_ECOLI')
00756         self.assertEqual(motif.instances[11].sequence_name, 'DHB2_HUMAN')
00757         self.assertEqual(motif.instances[12].sequence_name, 'DHMA_FLAS1')
00758         self.assertEqual(motif.instances[13].sequence_name, 'HDE_CANTR')
00759         self.assertEqual(motif.instances[14].sequence_name, 'FVT1_HUMAN')
00760         self.assertEqual(motif.instances[15].sequence_name, 'BDH_HUMAN')
00761         self.assertEqual(motif.instances[16].sequence_name, 'RIDH_KLEAE')
00762         self.assertEqual(motif.instances[17].sequence_name, 'DHES_HUMAN')
00763         self.assertEqual(motif.instances[18].sequence_name, 'BA72_EUBSP')
00764         self.assertEqual(motif.instances[19].sequence_name, 'LIGD_PSEPA')
00765         self.assertEqual(motif.instances[20].sequence_name, 'DHII_HUMAN')
00766         self.assertEqual(motif.instances[21].sequence_name, 'ENTA_ECOLI')
00767         self.assertEqual(motif.instances[22].sequence_name, '3BHD_COMTE')
00768         self.assertEqual(motif.instances[23].sequence_name, 'DHB3_HUMAN')
00769         self.assertEqual(motif.instances[24].sequence_name, 'RFBB_NEIGO')
00770         self.assertEqual(motif.instances[25].sequence_name, 'YINL_LISMO')
00771         self.assertEqual(motif.instances[26].sequence_name, 'BPHB_PSEPS')
00772         self.assertEqual(motif.instances[27].sequence_name, 'CSGA_MYXXA')
00773         self.assertEqual(motif.instances[28].sequence_name, 'FABI_ECOLI')
00774         self.assertEqual(motif.instances[29].sequence_name, 'ADH_DROME')
00775         self.assertEqual(motif.instances[30].sequence_name, 'DHCA_HUMAN')
00776         self.assertEqual(motif.instances[31].sequence_name, 'PCR_PEA')
00777         self.assertEqual(motif.instances[32].sequence_name, 'MAS1_AGRRA')
00778         self.assertEqual(motif.instances[0].strand, '+')
00779         self.assertEqual(motif.instances[1].strand, '+')
00780         self.assertEqual(motif.instances[2].strand, '+')
00781         self.assertEqual(motif.instances[3].strand, '+')
00782         self.assertEqual(motif.instances[4].strand, '+')
00783         self.assertEqual(motif.instances[5].strand, '+')
00784         self.assertEqual(motif.instances[6].strand, '+')
00785         self.assertEqual(motif.instances[7].strand, '+')
00786         self.assertEqual(motif.instances[8].strand, '+')
00787         self.assertEqual(motif.instances[9].strand, '+')
00788         self.assertEqual(motif.instances[10].strand, '+')
00789         self.assertEqual(motif.instances[11].strand, '+')
00790         self.assertEqual(motif.instances[12].strand, '+')
00791         self.assertEqual(motif.instances[13].strand, '+')
00792         self.assertEqual(motif.instances[14].strand, '+')
00793         self.assertEqual(motif.instances[15].strand, '+')
00794         self.assertEqual(motif.instances[16].strand, '+')
00795         self.assertEqual(motif.instances[17].strand, '+')
00796         self.assertEqual(motif.instances[18].strand, '+')
00797         self.assertEqual(motif.instances[19].strand, '+')
00798         self.assertEqual(motif.instances[20].strand, '+')
00799         self.assertEqual(motif.instances[21].strand, '+')
00800         self.assertEqual(motif.instances[22].strand, '+')
00801         self.assertEqual(motif.instances[23].strand, '+')
00802         self.assertEqual(motif.instances[24].strand, '+')
00803         self.assertEqual(motif.instances[25].strand, '+')
00804         self.assertEqual(motif.instances[26].strand, '+')
00805         self.assertEqual(motif.instances[27].strand, '+')
00806         self.assertEqual(motif.instances[28].strand, '+')
00807         self.assertEqual(motif.instances[29].strand, '+')
00808         self.assertEqual(motif.instances[30].strand, '+')
00809         self.assertEqual(motif.instances[31].strand, '+')
00810         self.assertEqual(motif.instances[32].strand, '+')
00811         self.assertEqual(motif.instances[0].length, 29)
00812         self.assertEqual(motif.instances[1].length, 29)
00813         self.assertEqual(motif.instances[2].length, 29)
00814         self.assertEqual(motif.instances[3].length, 29)
00815         self.assertEqual(motif.instances[4].length, 29)
00816         self.assertEqual(motif.instances[5].length, 29)
00817         self.assertEqual(motif.instances[6].length, 29)
00818         self.assertEqual(motif.instances[7].length, 29)
00819         self.assertEqual(motif.instances[8].length, 29)
00820         self.assertEqual(motif.instances[9].length, 29)
00821         self.assertEqual(motif.instances[10].length, 29)
00822         self.assertEqual(motif.instances[11].length, 29)
00823         self.assertEqual(motif.instances[12].length, 29)
00824         self.assertEqual(motif.instances[13].length, 29)
00825         self.assertEqual(motif.instances[14].length, 29)
00826         self.assertEqual(motif.instances[15].length, 29)
00827         self.assertEqual(motif.instances[16].length, 29)
00828         self.assertEqual(motif.instances[17].length, 29)
00829         self.assertEqual(motif.instances[18].length, 29)
00830         self.assertEqual(motif.instances[19].length, 29)
00831         self.assertEqual(motif.instances[20].length, 29)
00832         self.assertEqual(motif.instances[21].length, 29)
00833         self.assertEqual(motif.instances[22].length, 29)
00834         self.assertEqual(motif.instances[23].length, 29)
00835         self.assertEqual(motif.instances[24].length, 29)
00836         self.assertEqual(motif.instances[25].length, 29)
00837         self.assertEqual(motif.instances[26].length, 29)
00838         self.assertEqual(motif.instances[27].length, 29)
00839         self.assertEqual(motif.instances[28].length, 29)
00840         self.assertEqual(motif.instances[29].length, 29)
00841         self.assertEqual(motif.instances[30].length, 29)
00842         self.assertEqual(motif.instances[31].length, 29)
00843         self.assertEqual(motif.instances[32].length, 29)
00844         self.assertEqual(motif.instances[0].start, 155)
00845         self.assertEqual(motif.instances[1].start, 149)
00846         self.assertEqual(motif.instances[2].start, 152)
00847         self.assertEqual(motif.instances[3].start, 152)
00848         self.assertEqual(motif.instances[4].start, 189)
00849         self.assertEqual(motif.instances[5].start, 160)
00850         self.assertEqual(motif.instances[6].start, 193)
00851         self.assertEqual(motif.instances[7].start, 160)
00852         self.assertEqual(motif.instances[8].start, 154)
00853         self.assertEqual(motif.instances[9].start, 152)
00854         self.assertEqual(motif.instances[10].start, 159)
00855         self.assertEqual(motif.instances[11].start, 232)
00856         self.assertEqual(motif.instances[12].start, 165)
00857         self.assertEqual(motif.instances[13].start, 467)
00858         self.assertEqual(motif.instances[14].start, 186)
00859         self.assertEqual(motif.instances[15].start, 208)
00860         self.assertEqual(motif.instances[16].start, 160)
00861         self.assertEqual(motif.instances[17].start, 155)
00862         self.assertEqual(motif.instances[18].start, 157)
00863         self.assertEqual(motif.instances[19].start, 157)
00864         self.assertEqual(motif.instances[20].start, 183)
00865         self.assertEqual(motif.instances[21].start, 144)
00866         self.assertEqual(motif.instances[22].start, 151)
00867         self.assertEqual(motif.instances[23].start, 198)
00868         self.assertEqual(motif.instances[24].start, 165)
00869         self.assertEqual(motif.instances[25].start, 154)
00870         self.assertEqual(motif.instances[26].start, 153)
00871         self.assertEqual(motif.instances[27].start,  88)
00872         self.assertEqual(motif.instances[28].start, 159)
00873         self.assertEqual(motif.instances[29].start, 152)
00874         self.assertEqual(motif.instances[30].start, 193)
00875         self.assertEqual(motif.instances[31].start,  26)
00876         self.assertEqual(motif.instances[32].start, 349)
00877         self.assertEqual(motif.instances[0].tostring(), "YSASKFAVLGLTESLMQEVRKHNIRVSAL")
00878         self.assertEqual(motif.instances[1].tostring(), "YSSTKGAMTMLTKAMAMELGPHKIRVNSV")
00879         self.assertEqual(motif.instances[2].tostring(), "YCASKAGMIGFSKSLAQEIATRNITVNCV")
00880         self.assertEqual(motif.instances[3].tostring(), "YSSSKFAVRGLTQTAARDLAPLGITVNGF")
00881         self.assertEqual(motif.instances[4].tostring(), "YATSKAALASLTRELAHDYAPHGIRVNAI")
00882         self.assertEqual(motif.instances[5].tostring(), "YAASKGGMKLMTETLALEYAPKGIRVNNI")
00883         self.assertEqual(motif.instances[6].tostring(), "YTMAKGALEGLTRSAALELAPLQIRVNGV")
00884         self.assertEqual(motif.instances[7].tostring(), "YSASKAFLSTFMESLRVDLRGTGVRVTCI")
00885         self.assertEqual(motif.instances[8].tostring(), "YSAAKFGGVGLTQSLALDLAEYGITVHSL")
00886         self.assertEqual(motif.instances[9].tostring(), "YGASKWGVRGLSKLAAVELGTDRIRVNSV")
00887         self.assertEqual(motif.instances[10].tostring(), "YASSKAAASHLVRNMAFDLGEKNIRVNGI")
00888         self.assertEqual(motif.instances[11].tostring(), "YGSSKAAVTMFSSVMRLELSKWGIKVASI")
00889         self.assertEqual(motif.instances[12].tostring(), "YVAAKGGVAMLTRAMAVDLARHGILVNMI")
00890         self.assertEqual(motif.instances[13].tostring(), "YSSSKAGILGLSKTMAIEGAKNNIKVNIV")
00891         self.assertEqual(motif.instances[14].tostring(), "YSASKFAIRGLAEALQMEVKPYNVYITVA")
00892         self.assertEqual(motif.instances[15].tostring(), "YCITKFGVEAFSDCLRYEMYPLGVKVSVV")
00893         self.assertEqual(motif.instances[16].tostring(), "YTASKFAVQAFVHTTRRQVAQYGVRVGAV")
00894         self.assertEqual(motif.instances[17].tostring(), "YCASKFALEGLCESLAVLLLPFGVHLSLI")
00895         self.assertEqual(motif.instances[18].tostring(), "YPASKASVIGLTHGLGREIIRKNIRVVGV")
00896         self.assertEqual(motif.instances[19].tostring(), "YSAAKAASINLMEGYRQGLEKYGIGVSVC")
00897         self.assertEqual(motif.instances[20].tostring(), "YSASKFALDGFFSSIRKEYSVSRVNVSIT")
00898         self.assertEqual(motif.instances[21].tostring(), "YGASKAALKSLALSVGLELAGSGVRCNVV")
00899         self.assertEqual(motif.instances[22].tostring(), "YSASKAAVSALTRAAALSCRKQGYAIRVN")
00900         self.assertEqual(motif.instances[23].tostring(), "YSASKAFVCAFSKALQEEYKAKEVIIQVL")
00901         self.assertEqual(motif.instances[24].tostring(), "YSASKAAADHLVRAWQRTYRLPSIVSNCS")
00902         self.assertEqual(motif.instances[25].tostring(), "YGATKWAVRDLMEVLRMESAQEGTNIRTA")
00903         self.assertEqual(motif.instances[26].tostring(), "YTAAKQAIVGLVRELAFELAPYVRVNGVG")
00904         self.assertEqual(motif.instances[27].tostring(), "YRMSKAALNMAVRSMSTDLRPEGFVTVLL")
00905         self.assertEqual(motif.instances[28].tostring(), "MGLAKASLEANVRYMANAMGPEGVRVNAI")
00906         self.assertEqual(motif.instances[29].tostring(), "YSGTKAAVVNFTSSLAKLAPITGVTAYTV")
00907         self.assertEqual(motif.instances[30].tostring(), "YGVTKIGVTVLSRIHARKLSEQRKGDKIL")
00908         self.assertEqual(motif.instances[31].tostring(), "KDSTLFGVSSLSDSLKGDFTSSALRCKEL")
00909         self.assertEqual(motif.instances[32].tostring(), "YINCVAPLRMTELCLPHLYETGSGRIVNI")
00910         motif = record.motifs[1]
00911         self.assertEqual(motif.num_occurrences, 33)
00912         self.assertAlmostEqual(motif.evalue, 2.3e-159)
00913         self.assertEqual(motif.alphabet, IUPAC.protein)
00914         self.assertEqual(, "Motif 2")
00915         self.assertEqual(len(motif.instances), 33)
00916         self.assertAlmostEqual(motif.instances[0].pvalue, 2.44e-23)
00917         self.assertAlmostEqual(motif.instances[1].pvalue, 5.50e-23)
00918         self.assertAlmostEqual(motif.instances[2].pvalue, 5.38e-22)
00919         self.assertAlmostEqual(motif.instances[3].pvalue, 5.65e-20)
00920         self.assertAlmostEqual(motif.instances[4].pvalue, 1.17e-19)
00921         self.assertAlmostEqual(motif.instances[5].pvalue, 1.17e-19)
00922         self.assertAlmostEqual(motif.instances[6].pvalue, 4.74e-19)
00923         self.assertAlmostEqual(motif.instances[7].pvalue, 9.31e-19)
00924         self.assertAlmostEqual(motif.instances[8].pvalue, 2.50e-18)
00925         self.assertAlmostEqual(motif.instances[9].pvalue, 3.45e-18)
00926         self.assertAlmostEqual(motif.instances[10].pvalue, 5.86e-18)
00927         self.assertAlmostEqual(motif.instances[11].pvalue, 9.86e-18)
00928         self.assertAlmostEqual(motif.instances[12].pvalue, 2.47e-17)
00929         self.assertAlmostEqual(motif.instances[13].pvalue, 3.01e-17)
00930         self.assertAlmostEqual(motif.instances[14].pvalue, 3.33e-17)
00931         self.assertAlmostEqual(motif.instances[15].pvalue, 4.06e-17)
00932         self.assertAlmostEqual(motif.instances[16].pvalue, 4.06e-17)
00933         self.assertAlmostEqual(motif.instances[17].pvalue, 8.05e-17)
00934         self.assertAlmostEqual(motif.instances[18].pvalue, 1.90e-16)
00935         self.assertAlmostEqual(motif.instances[19].pvalue, 2.77e-16)
00936         self.assertAlmostEqual(motif.instances[20].pvalue, 3.65e-16)
00937         self.assertAlmostEqual(motif.instances[21].pvalue, 8.31e-16)
00938         self.assertAlmostEqual(motif.instances[22].pvalue, 4.05e-15)
00939         self.assertAlmostEqual(motif.instances[23].pvalue, 5.24e-15)
00940         self.assertAlmostEqual(motif.instances[24].pvalue, 3.00e-14)
00941         self.assertAlmostEqual(motif.instances[25].pvalue, 8.47e-14)
00942         self.assertAlmostEqual(motif.instances[26].pvalue, 1.46e-13)
00943         self.assertAlmostEqual(motif.instances[27].pvalue, 1.46e-13)
00944         self.assertAlmostEqual(motif.instances[28].pvalue, 1.59e-12)
00945         self.assertAlmostEqual(motif.instances[29].pvalue, 6.97e-10)
00946         self.assertAlmostEqual(motif.instances[30].pvalue, 3.15e-09)
00947         self.assertAlmostEqual(motif.instances[31].pvalue, 2.77e-07)
00948         self.assertAlmostEqual(motif.instances[32].pvalue, 4.24e-07)
00949         self.assertEqual(motif.instances[0].sequence_name, 'HDE_CANTR')
00950         self.assertEqual(motif.instances[1].sequence_name, 'DHII_HUMAN')
00951         self.assertEqual(motif.instances[2].sequence_name, 'YINL_LISMO')
00952         self.assertEqual(motif.instances[3].sequence_name, 'HDHA_ECOLI')
00953         self.assertEqual(motif.instances[4].sequence_name, 'RIDH_KLEAE')
00954         self.assertEqual(motif.instances[5].sequence_name, 'BUDC_KLETE')
00955         self.assertEqual(motif.instances[6].sequence_name, 'ENTA_ECOLI')
00956         self.assertEqual(motif.instances[7].sequence_name, 'AP27_MOUSE')
00957         self.assertEqual(motif.instances[8].sequence_name, 'DHMA_FLAS1')
00958         self.assertEqual(motif.instances[9].sequence_name, 'YRTP_BACSU')
00959         self.assertEqual(motif.instances[10].sequence_name, 'DHGB_BACME')
00960         self.assertEqual(motif.instances[11].sequence_name, 'DHB3_HUMAN')
00961         self.assertEqual(motif.instances[12].sequence_name, 'PCR_PEA')
00962         self.assertEqual(motif.instances[13].sequence_name, 'BDH_HUMAN')
00963         self.assertEqual(motif.instances[14].sequence_name, 'BA72_EUBSP')
00964         self.assertEqual(motif.instances[15].sequence_name, 'FIXR_BRAJA')
00965         self.assertEqual(motif.instances[16].sequence_name, '3BHD_COMTE')
00966         self.assertEqual(motif.instances[17].sequence_name, '2BHD_STREX')
00967         self.assertEqual(motif.instances[18].sequence_name, 'HMTR_LEIMA')
00968         self.assertEqual(motif.instances[19].sequence_name, 'FVT1_HUMAN')
00969         self.assertEqual(motif.instances[20].sequence_name, 'DHB2_HUMAN')
00970         self.assertEqual(motif.instances[21].sequence_name, 'LIGD_PSEPA')
00971         self.assertEqual(motif.instances[22].sequence_name, 'NODG_RHIME')
00972         self.assertEqual(motif.instances[23].sequence_name, 'DHCA_HUMAN')
00973         self.assertEqual(motif.instances[24].sequence_name, 'MAS1_AGRRA')
00974         self.assertEqual(motif.instances[25].sequence_name, 'BPHB_PSEPS')
00975         self.assertEqual(motif.instances[26].sequence_name, 'GUTD_ECOLI')
00976         self.assertEqual(motif.instances[27].sequence_name, 'DHES_HUMAN')
00977         self.assertEqual(motif.instances[28].sequence_name, 'RFBB_NEIGO')
00978         self.assertEqual(motif.instances[29].sequence_name, 'ADH_DROME')
00979         self.assertEqual(motif.instances[30].sequence_name, 'FABI_ECOLI')
00980         self.assertEqual(motif.instances[31].sequence_name, 'YURA_MYXXA')
00981         self.assertEqual(motif.instances[32].sequence_name, 'CSGA_MYXXA')
00982         self.assertEqual(motif.instances[0].start, 323)
00983         self.assertEqual(motif.instances[1].start, 35)
00984         self.assertEqual(motif.instances[2].start, 6)
00985         self.assertEqual(motif.instances[3].start, 12)
00986         self.assertEqual(motif.instances[4].start, 15)
00987         self.assertEqual(motif.instances[5].start, 3)
00988         self.assertEqual(motif.instances[6].start, 6)
00989         self.assertEqual(motif.instances[7].start, 8)
00990         self.assertEqual(motif.instances[8].start, 15)
00991         self.assertEqual(motif.instances[9].start, 7)
00992         self.assertEqual(motif.instances[10].start, 8)
00993         self.assertEqual(motif.instances[11].start, 49)
00994         self.assertEqual(motif.instances[12].start, 87)
00995         self.assertEqual(motif.instances[13].start, 56)
00996         self.assertEqual(motif.instances[14].start, 7)
00997         self.assertEqual(motif.instances[15].start, 37)
00998         self.assertEqual(motif.instances[16].start, 7)
00999         self.assertEqual(motif.instances[17].start, 7)
01000         self.assertEqual(motif.instances[18].start, 7)
01001         self.assertEqual(motif.instances[19].start, 33)
01002         self.assertEqual(motif.instances[20].start, 83)
01003         self.assertEqual(motif.instances[21].start, 7)
01004         self.assertEqual(motif.instances[22].start, 7)
01005         self.assertEqual(motif.instances[23].start, 5)
01006         self.assertEqual(motif.instances[24].start, 246)
01007         self.assertEqual(motif.instances[25].start, 6)
01008         self.assertEqual(motif.instances[26].start, 3)
01009         self.assertEqual(motif.instances[27].start, 3)
01010         self.assertEqual(motif.instances[28].start, 7)
01011         self.assertEqual(motif.instances[29].start, 7)
01012         self.assertEqual(motif.instances[30].start, 7)
01013         self.assertEqual(motif.instances[31].start, 117)
01014         self.assertEqual(motif.instances[32].start, 52)
01015         self.assertEqual(motif.instances[0].tostring(), 'KVVLITGAGAGLGKEYAKWFAKYGAKVVV')
01016         self.assertEqual(motif.instances[1].tostring(), 'KKVIVTGASKGIGREMAYHLAKMGAHVVV')
01017         self.assertEqual(motif.instances[2].tostring(), 'KVIIITGASSGIGKATALLLAEKGAKLVL')
01018         self.assertEqual(motif.instances[3].tostring(), 'KCAIITGAGAGIGKEIAITFATAGASVVV')
01019         self.assertEqual(motif.instances[4].tostring(), 'KVAAITGAASGIGLECARTLLGAGAKVVL')
01020         self.assertEqual(motif.instances[5].tostring(), 'KVALVTGAGQGIGKAIALRLVKDGFAVAI')
01021         self.assertEqual(motif.instances[6].tostring(), 'KNVWVTGAGKGIGYATALAFVEAGAKVTG')
01022         self.assertEqual(motif.instances[7].tostring(), 'LRALVTGAGKGIGRDTVKALHASGAKVVA')
01023         self.assertEqual(motif.instances[8].tostring(), 'KAAIVTGAAGGIGRATVEAYLREGASVVA')
01024         self.assertEqual(motif.instances[9].tostring(), 'KTALITGGGRGIGRATALALAKEGVNIGL')
01025         self.assertEqual(motif.instances[10].tostring(), 'KVVVITGSSTGLGKSMAIRFATEKAKVVV')
01026         self.assertEqual(motif.instances[11].tostring(), 'QWAVITGAGDGIGKAYSFELAKRGLNVVL')
01027         self.assertEqual(motif.instances[12].tostring(), 'GNVVITGASSGLGLATAKALAESGKWHVI')
01028         self.assertEqual(motif.instances[13].tostring(), 'KAVLVTGCDSGFGFSLAKHLHSKGFLVFA')
01029         self.assertEqual(motif.instances[14].tostring(), 'KVTIITGGTRGIGFAAAKIFIDNGAKVSI')
01030         self.assertEqual(motif.instances[15].tostring(), 'KVMLLTGASRGIGHATAKLFSEAGWRIIS')
01031         self.assertEqual(motif.instances[16].tostring(), 'KVALVTGGASGVGLEVVKLLLGEGAKVAF')
01032         self.assertEqual(motif.instances[17].tostring(), 'KTVIITGGARGLGAEAARQAVAAGARVVL')
01033         self.assertEqual(motif.instances[18].tostring(), 'PVALVTGAAKRLGRSIAEGLHAEGYAVCL')
01034         self.assertEqual(motif.instances[19].tostring(), 'AHVVVTGGSSGIGKCIAIECYKQGAFITL')
01035         self.assertEqual(motif.instances[20].tostring(), 'KAVLVTGGDCGLGHALCKYLDELGFTVFA')
01036         self.assertEqual(motif.instances[21].tostring(), 'QVAFITGGASGAGFGQAKVFGQAGAKIVV')
01037         self.assertEqual(motif.instances[22].tostring(), 'RKALVTGASGAIGGAIARVLHAQGAIVGL')
01038         self.assertEqual(motif.instances[23].tostring(), 'HVALVTGGNKGIGLAIVRDLCRLFSGDVV')
01039         self.assertEqual(motif.instances[24].tostring(), 'PVILVSGSNRGVGKAIAEDLIAHGYRLSL')
01040         self.assertEqual(motif.instances[25].tostring(), 'EAVLITGGASGLGRALVDRFVAEAKVAVL')
01041         self.assertEqual(motif.instances[26].tostring(), 'QVAVVIGGGQTLGAFLCHGLAAEGYRVAV')
01042         self.assertEqual(motif.instances[27].tostring(), 'TVVLITGCSSGIGLHLAVRLASDPSQSFK')
01043         self.assertEqual(motif.instances[28].tostring(), 'KNILVTGGAGFIGSAVVRHIIQNTRDSVV')
01044         self.assertEqual(motif.instances[29].tostring(), 'KNVIFVAGLGGIGLDTSKELLKRDLKNLV')
01045         self.assertEqual(motif.instances[30].tostring(), 'KRILVTGVASKLSIAYGIAQAMHREGAEL')
01046         self.assertEqual(motif.instances[31].tostring(), 'IDTNVTGAAATLSAVLPQMVERKRGHLVG')
01047         self.assertEqual(motif.instances[32].tostring(), 'TSAMLPGLRQGALRRVAHVTSRMGSLAAN')
01048         handle.close()
01050     def test_meme_parser_4(self):
01051         """Test if Motif can parse MEME output files (fourth test)
01052         """
01053         from Bio.Alphabet import IUPAC
01054         from Bio.Motif.Parsers import MEME
01055         handle = open("Motif/meme.protein.tcm.txt")
01056         record =
01057         self.assertEqual(record.version, '3.0')
01058         self.assertEqual(record.datafile, 'farntrans5.s')
01059         self.assertEqual(record.alphabet, IUPAC.protein)
01060         self.assertEqual(len(record.sequence_names), 5)
01061         self.assertEqual(record.sequence_names[0], "RAM1_YEAST")
01062         self.assertEqual(record.sequence_names[1], "PFTB_RAT")
01063         self.assertEqual(record.sequence_names[2], "BET2_YEAST")
01064         self.assertEqual(record.sequence_names[3], "RATRABGERB")
01065         self.assertEqual(record.sequence_names[4], "CAL1_YEAST")
01066         self.assertEqual(record.command, 'meme farntrans5.s -mod tcm -protein -nmotifs 2')
01067         self.assertEqual(len(record.motifs), 2)
01068         motif = record.motifs[0]
01069         self.assertEqual(motif.num_occurrences, 24)
01070         self.assertAlmostEqual(motif.evalue, 2.2e-94)
01071         self.assertEqual(motif.alphabet, IUPAC.protein)
01072         self.assertEqual(, "Motif 1")
01073         self.assertEqual(len(motif.instances), 24)
01074         self.assertAlmostEqual(motif.instances[0].pvalue, 7.28e-22)
01075         self.assertAlmostEqual(motif.instances[1].pvalue, 6.18e-21)
01076         self.assertAlmostEqual(motif.instances[2].pvalue, 9.17e-20)
01077         self.assertAlmostEqual(motif.instances[3].pvalue, 1.15e-19)
01078         self.assertAlmostEqual(motif.instances[4].pvalue, 4.30e-19)
01079         self.assertAlmostEqual(motif.instances[5].pvalue, 7.36e-19)
01080         self.assertAlmostEqual(motif.instances[6].pvalue, 8.19e-19)
01081         self.assertAlmostEqual(motif.instances[7].pvalue, 2.10e-18)
01082         self.assertAlmostEqual(motif.instances[8].pvalue, 1.43e-17)
01083         self.assertAlmostEqual(motif.instances[9].pvalue, 3.41e-17)
01084         self.assertAlmostEqual(motif.instances[10].pvalue, 5.00e-17)
01085         self.assertAlmostEqual(motif.instances[11].pvalue, 6.64e-17)
01086         self.assertAlmostEqual(motif.instances[12].pvalue, 1.27e-16)
01087         self.assertAlmostEqual(motif.instances[13].pvalue, 3.17e-16)
01088         self.assertAlmostEqual(motif.instances[14].pvalue, 3.47e-16)
01089         self.assertAlmostEqual(motif.instances[15].pvalue, 4.30e-15)
01090         self.assertAlmostEqual(motif.instances[16].pvalue, 2.40e-14)
01091         self.assertAlmostEqual(motif.instances[17].pvalue, 2.81e-14)
01092         self.assertAlmostEqual(motif.instances[18].pvalue, 7.78e-14)
01093         self.assertAlmostEqual(motif.instances[19].pvalue, 1.14e-13)
01094         self.assertAlmostEqual(motif.instances[20].pvalue, 1.33e-13)
01095         self.assertAlmostEqual(motif.instances[21].pvalue, 3.52e-13)
01096         self.assertAlmostEqual(motif.instances[22].pvalue, 5.47e-13)
01097         self.assertAlmostEqual(motif.instances[23].pvalue, 3.11e-10)
01098         self.assertEqual(motif.instances[0].sequence_name, "BET2_YEAST")
01099         self.assertEqual(motif.instances[1].sequence_name, "RATRABGERB")
01100         self.assertEqual(motif.instances[2].sequence_name, "CAL1_YEAST")
01101         self.assertEqual(motif.instances[3].sequence_name, "PFTB_RAT")
01102         self.assertEqual(motif.instances[4].sequence_name, "PFTB_RAT")
01103         self.assertEqual(motif.instances[5].sequence_name, "RATRABGERB")
01104         self.assertEqual(motif.instances[6].sequence_name, "RATRABGERB")
01105         self.assertEqual(motif.instances[7].sequence_name, "BET2_YEAST")
01106         self.assertEqual(motif.instances[8].sequence_name, "RATRABGERB")
01107         self.assertEqual(motif.instances[9].sequence_name, "BET2_YEAST")
01108         self.assertEqual(motif.instances[10].sequence_name, "RAM1_YEAST")
01109         self.assertEqual(motif.instances[11].sequence_name, "BET2_YEAST")
01110         self.assertEqual(motif.instances[12].sequence_name, "RAM1_YEAST")
01111         self.assertEqual(motif.instances[13].sequence_name, "PFTB_RAT")
01112         self.assertEqual(motif.instances[14].sequence_name, "RAM1_YEAST")
01113         self.assertEqual(motif.instances[15].sequence_name, "PFTB_RAT")
01114         self.assertEqual(motif.instances[16].sequence_name, "RATRABGERB")
01115         self.assertEqual(motif.instances[17].sequence_name, "PFTB_RAT")
01116         self.assertEqual(motif.instances[18].sequence_name, "BET2_YEAST")
01117         self.assertEqual(motif.instances[19].sequence_name, "CAL1_YEAST")
01118         self.assertEqual(motif.instances[20].sequence_name, "RAM1_YEAST")
01119         self.assertEqual(motif.instances[21].sequence_name, "RAM1_YEAST")
01120         self.assertEqual(motif.instances[22].sequence_name, "CAL1_YEAST")
01121         self.assertEqual(motif.instances[23].sequence_name, "BET2_YEAST")
01122         self.assertEqual(motif.instances[0].strand, '+')
01123         self.assertEqual(motif.instances[1].strand, '+')
01124         self.assertEqual(motif.instances[2].strand, '+')
01125         self.assertEqual(motif.instances[3].strand, '+')
01126         self.assertEqual(motif.instances[4].strand, '+')
01127         self.assertEqual(motif.instances[5].strand, '+')
01128         self.assertEqual(motif.instances[6].strand, '+')
01129         self.assertEqual(motif.instances[7].strand, '+')
01130         self.assertEqual(motif.instances[8].strand, '+')
01131         self.assertEqual(motif.instances[9].strand, '+')
01132         self.assertEqual(motif.instances[10].strand, '+')
01133         self.assertEqual(motif.instances[11].strand, '+')
01134         self.assertEqual(motif.instances[12].strand, '+')
01135         self.assertEqual(motif.instances[13].strand, '+')
01136         self.assertEqual(motif.instances[14].strand, '+')
01137         self.assertEqual(motif.instances[15].strand, '+')
01138         self.assertEqual(motif.instances[16].strand, '+')
01139         self.assertEqual(motif.instances[17].strand, '+')
01140         self.assertEqual(motif.instances[18].strand, '+')
01141         self.assertEqual(motif.instances[19].strand, '+')
01142         self.assertEqual(motif.instances[20].strand, '+')
01143         self.assertEqual(motif.instances[21].strand, '+')
01144         self.assertEqual(motif.instances[22].strand, '+')
01145         self.assertEqual(motif.instances[23].strand, '+')
01146         self.assertEqual(motif.instances[0].length, 30)
01147         self.assertEqual(motif.instances[1].length, 30)
01148         self.assertEqual(motif.instances[2].length, 30)
01149         self.assertEqual(motif.instances[3].length, 30)
01150         self.assertEqual(motif.instances[4].length, 30)
01151         self.assertEqual(motif.instances[5].length, 30)
01152         self.assertEqual(motif.instances[6].length, 30)
01153         self.assertEqual(motif.instances[7].length, 30)
01154         self.assertEqual(motif.instances[8].length, 30)
01155         self.assertEqual(motif.instances[9].length, 30)
01156         self.assertEqual(motif.instances[10].length, 30)
01157         self.assertEqual(motif.instances[11].length, 30)
01158         self.assertEqual(motif.instances[12].length, 30)
01159         self.assertEqual(motif.instances[13].length, 30)
01160         self.assertEqual(motif.instances[14].length, 30)
01161         self.assertEqual(motif.instances[15].length, 30)
01162         self.assertEqual(motif.instances[16].length, 30)
01163         self.assertEqual(motif.instances[17].length, 30)
01164         self.assertEqual(motif.instances[18].length, 30)
01165         self.assertEqual(motif.instances[19].length, 30)
01166         self.assertEqual(motif.instances[20].length, 30)
01167         self.assertEqual(motif.instances[21].length, 30)
01168         self.assertEqual(motif.instances[22].length, 30)
01169         self.assertEqual(motif.instances[23].length, 30)
01170         self.assertEqual(motif.instances[0].start, 223)
01171         self.assertEqual(motif.instances[1].start, 227)
01172         self.assertEqual(motif.instances[2].start, 275)
01173         self.assertEqual(motif.instances[3].start, 237)
01174         self.assertEqual(motif.instances[4].start, 138)
01175         self.assertEqual(motif.instances[5].start, 179)
01176         self.assertEqual(motif.instances[6].start, 131)
01177         self.assertEqual(motif.instances[7].start, 172)
01178         self.assertEqual(motif.instances[8].start, 276)
01179         self.assertEqual(motif.instances[9].start, 124)
01180         self.assertEqual(motif.instances[10].start, 247)
01181         self.assertEqual(motif.instances[11].start, 272)
01182         self.assertEqual(motif.instances[12].start, 145)
01183         self.assertEqual(motif.instances[13].start, 286)
01184         self.assertEqual(motif.instances[14].start, 296)
01185         self.assertEqual(motif.instances[15].start, 348)
01186         self.assertEqual(motif.instances[16].start, 83)
01187         self.assertEqual(motif.instances[17].start, 189)
01188         self.assertEqual(motif.instances[18].start, 73)
01189         self.assertEqual(motif.instances[19].start, 205)
01190         self.assertEqual(motif.instances[20].start, 198)
01191         self.assertEqual(motif.instances[21].start, 349)
01192         self.assertEqual(motif.instances[22].start, 327)
01193         self.assertEqual(motif.instances[23].start, 24)
01194         self.assertEqual(motif.instances[0].tostring(), "GGLNGRPSKLPDVCYSWWVLSSLAIIGRLD")
01195         self.assertEqual(motif.instances[1].tostring(), "GGLNGRPEKLPDVCYSWWVLASLKIIGRLH")
01196         self.assertEqual(motif.instances[2].tostring(), "GGFQGRENKFADTCYAFWCLNSLHLLTKDW")
01197         self.assertEqual(motif.instances[3].tostring(), "GGIGGVPGMEAHGGYTFCGLAALVILKKER")
01198         self.assertEqual(motif.instances[4].tostring(), "GGFGGGPGQYPHLAPTYAAVNALCIIGTEE")
01199         self.assertEqual(motif.instances[5].tostring(), "GGFGCRPGSESHAGQIYCCTGFLAITSQLH")
01200         self.assertEqual(motif.instances[6].tostring(), "GSFAGDIWGEIDTRFSFCAVATLALLGKLD")
01201         self.assertEqual(motif.instances[7].tostring(), "GGFGLCPNAESHAAQAFTCLGALAIANKLD")
01202         self.assertEqual(motif.instances[8].tostring(), "GGFADRPGDMVDPFHTLFGIAGLSLLGEEQ")
01203         self.assertEqual(motif.instances[9].tostring(), "GSFQGDRFGEVDTRFVYTALSALSILGELT")
01204         self.assertEqual(motif.instances[10].tostring(), "GFGSCPHVDEAHGGYTFCATASLAILRSMD")
01205         self.assertEqual(motif.instances[11].tostring(), "GGISDRPENEVDVFHTVFGVAGLSLMGYDN")
01206         self.assertEqual(motif.instances[12].tostring(), "GPFGGGPGQLSHLASTYAAINALSLCDNID")
01207         self.assertEqual(motif.instances[13].tostring(), "GGFQGRCNKLVDGCYSFWQAGLLPLLHRAL")
01208         self.assertEqual(motif.instances[14].tostring(), "RGFCGRSNKLVDGCYSFWVGGSAAILEAFG")
01209         self.assertEqual(motif.instances[15].tostring(), "GGLLDKPGKSRDFYHTCYCLSGLSIAQHFG")
01210         self.assertEqual(motif.instances[16].tostring(), "GGVSASIGHDPHLLYTLSAVQILTLYDSIH")
01211         self.assertEqual(motif.instances[17].tostring(), "GSFLMHVGGEVDVRSAYCAASVASLTNIIT")
01212         self.assertEqual(motif.instances[18].tostring(), "GAFAPFPRHDAHLLTTLSAVQILATYDALD")
01213         self.assertEqual(motif.instances[19].tostring(), "YNGAFGAHNEPHSGYTSCALSTLALLSSLE")
01214         self.assertEqual(motif.instances[20].tostring(), "GFKTCLEVGEVDTRGIYCALSIATLLNILT")
01215         self.assertEqual(motif.instances[21].tostring(), "PGLRDKPGAHSDFYHTNYCLLGLAVAESSY")
01216         self.assertEqual(motif.instances[22].tostring(), "GGFSKNDEEDADLYHSCLGSAALALIEGKF")
01217         self.assertEqual(motif.instances[23].tostring(), "HNFEYWLTEHLRLNGIYWGLTALCVLDSPE")
01218         motif = record.motifs[1]
01219         self.assertEqual(motif.num_occurrences, 21)
01220         self.assertAlmostEqual(motif.evalue, 3.1e-19)
01221         self.assertEqual(motif.alphabet, IUPAC.protein)
01222         self.assertEqual(, "Motif 2")
01223         self.assertEqual(len(motif.instances), 21)
01224         self.assertAlmostEqual(motif.instances[0].pvalue, 2.24e-13)
01225         self.assertAlmostEqual(motif.instances[1].pvalue, 1.30e-12)
01226         self.assertAlmostEqual(motif.instances[2].pvalue, 4.20e-12)
01227         self.assertAlmostEqual(motif.instances[3].pvalue, 9.60e-12)
01228         self.assertAlmostEqual(motif.instances[4].pvalue, 5.08e-11)
01229         self.assertAlmostEqual(motif.instances[5].pvalue, 5.01e-10)
01230         self.assertAlmostEqual(motif.instances[6].pvalue, 6.90e-10)
01231         self.assertAlmostEqual(motif.instances[7].pvalue, 1.57e-09)
01232         self.assertAlmostEqual(motif.instances[8].pvalue, 2.34e-09)
01233         self.assertAlmostEqual(motif.instances[9].pvalue, 4.59e-09)
01234         self.assertAlmostEqual(motif.instances[10].pvalue, 1.65e-08)
01235         self.assertAlmostEqual(motif.instances[11].pvalue, 1.65e-08)
01236         self.assertAlmostEqual(motif.instances[12].pvalue, 1.65e-08)
01237         self.assertAlmostEqual(motif.instances[13].pvalue, 2.54e-08)
01238         self.assertAlmostEqual(motif.instances[14].pvalue, 4.58e-08)
01239         self.assertAlmostEqual(motif.instances[15].pvalue, 5.86e-08)
01240         self.assertAlmostEqual(motif.instances[16].pvalue, 1.52e-07)
01241         self.assertAlmostEqual(motif.instances[17].pvalue, 1.91e-07)
01242         self.assertAlmostEqual(motif.instances[18].pvalue, 4.34e-07)
01243         self.assertAlmostEqual(motif.instances[19].pvalue, 5.01e-07)
01244         self.assertAlmostEqual(motif.instances[20].pvalue, 5.78e-07)
01245         self.assertEqual(motif.instances[0].sequence_name, "BET2_YEAST")
01246         self.assertEqual(motif.instances[1].sequence_name, "RATRABGERB")
01247         self.assertEqual(motif.instances[2].sequence_name, "RATRABGERB")
01248         self.assertEqual(motif.instances[3].sequence_name, "RATRABGERB")
01249         self.assertEqual(motif.instances[4].sequence_name, "RAM1_YEAST")
01250         self.assertEqual(motif.instances[5].sequence_name, "CAL1_YEAST")
01251         self.assertEqual(motif.instances[6].sequence_name, "BET2_YEAST")
01252         self.assertEqual(motif.instances[7].sequence_name, "RATRABGERB")
01253         self.assertEqual(motif.instances[8].sequence_name, "PFTB_RAT")
01254         self.assertEqual(motif.instances[9].sequence_name, "RAM1_YEAST")
01255         self.assertEqual(motif.instances[10].sequence_name, "CAL1_YEAST")
01256         self.assertEqual(motif.instances[11].sequence_name, "PFTB_RAT")
01257         self.assertEqual(motif.instances[12].sequence_name, "PFTB_RAT")
01258         self.assertEqual(motif.instances[13].sequence_name, "RAM1_YEAST")
01259         self.assertEqual(motif.instances[14].sequence_name, "PFTB_RAT")
01260         self.assertEqual(motif.instances[15].sequence_name, "CAL1_YEAST")
01261         self.assertEqual(motif.instances[16].sequence_name, "PFTB_RAT")
01262         self.assertEqual(motif.instances[17].sequence_name, "CAL1_YEAST")
01263         self.assertEqual(motif.instances[18].sequence_name, "BET2_YEAST")
01264         self.assertEqual(motif.instances[19].sequence_name, "BET2_YEAST")
01265         self.assertEqual(motif.instances[20].sequence_name, "RAM1_YEAST")
01266         self.assertEqual(motif.instances[0].strand, '+')
01267         self.assertEqual(motif.instances[1].strand, '+')
01268         self.assertEqual(motif.instances[2].strand, '+')
01269         self.assertEqual(motif.instances[3].strand, '+')
01270         self.assertEqual(motif.instances[4].strand, '+')
01271         self.assertEqual(motif.instances[5].strand, '+')
01272         self.assertEqual(motif.instances[6].strand, '+')
01273         self.assertEqual(motif.instances[7].strand, '+')
01274         self.assertEqual(motif.instances[8].strand, '+')
01275         self.assertEqual(motif.instances[9].strand, '+')
01276         self.assertEqual(motif.instances[10].strand, '+')
01277         self.assertEqual(motif.instances[11].strand, '+')
01278         self.assertEqual(motif.instances[12].strand, '+')
01279         self.assertEqual(motif.instances[13].strand, '+')
01280         self.assertEqual(motif.instances[14].strand, '+')
01281         self.assertEqual(motif.instances[15].strand, '+')
01282         self.assertEqual(motif.instances[16].strand, '+')
01283         self.assertEqual(motif.instances[17].strand, '+')
01284         self.assertEqual(motif.instances[18].strand, '+')
01285         self.assertEqual(motif.instances[19].strand, '+')
01286         self.assertEqual(motif.instances[20].strand, '+')
01287         self.assertEqual(motif.instances[0].length, 14)
01288         self.assertEqual(motif.instances[1].length, 14)
01289         self.assertEqual(motif.instances[2].length, 14)
01290         self.assertEqual(motif.instances[3].length, 14)
01291         self.assertEqual(motif.instances[4].length, 14)
01292         self.assertEqual(motif.instances[5].length, 14)
01293         self.assertEqual(motif.instances[6].length, 14)
01294         self.assertEqual(motif.instances[7].length, 14)
01295         self.assertEqual(motif.instances[8].length, 14)
01296         self.assertEqual(motif.instances[9].length, 14)
01297         self.assertEqual(motif.instances[10].length, 14)
01298         self.assertEqual(motif.instances[11].length, 14)
01299         self.assertEqual(motif.instances[12].length, 14)
01300         self.assertEqual(motif.instances[13].length, 14)
01301         self.assertEqual(motif.instances[14].length, 14)
01302         self.assertEqual(motif.instances[15].length, 14)
01303         self.assertEqual(motif.instances[16].length, 14)
01304         self.assertEqual(motif.instances[17].length, 14)
01305         self.assertEqual(motif.instances[18].length, 14)
01306         self.assertEqual(motif.instances[19].length, 14)
01307         self.assertEqual(motif.instances[20].length, 14)
01308         self.assertEqual(motif.instances[0].start, 254)
01309         self.assertEqual(motif.instances[1].start, 258)
01310         self.assertEqual(motif.instances[2].start, 162)
01311         self.assertEqual(motif.instances[3].start,  66)
01312         self.assertEqual(motif.instances[4].start, 278)
01313         self.assertEqual(motif.instances[5].start, 190)
01314         self.assertEqual(motif.instances[6].start,  55)
01315         self.assertEqual(motif.instances[7].start, 114)
01316         self.assertEqual(motif.instances[8].start, 172)
01317         self.assertEqual(motif.instances[9].start, 330)
01318         self.assertEqual(motif.instances[10].start, 126)
01319         self.assertEqual(motif.instances[11].start, 268)
01320         self.assertEqual(motif.instances[12].start, 220)
01321         self.assertEqual(motif.instances[13].start, 229)
01322         self.assertEqual(motif.instances[14].start, 330)
01323         self.assertEqual(motif.instances[15].start, 239)
01324         self.assertEqual(motif.instances[16].start, 121)
01325         self.assertEqual(motif.instances[17].start, 362)
01326         self.assertEqual(motif.instances[18].start, 107)
01327         self.assertEqual(motif.instances[19].start, 155)
01328         self.assertEqual(motif.instances[20].start, 180)
01329         self.assertEqual(motif.instances[0].tostring(), "INYEKLTEFILKCQ")
01330         self.assertEqual(motif.instances[1].tostring(), "IDREKLRSFILACQ")
01331         self.assertEqual(motif.instances[2].tostring(), "INVEKAIEFVLSCM")
01332         self.assertEqual(motif.instances[3].tostring(), "MNKEEILVFIKSCQ")
01333         self.assertEqual(motif.instances[4].tostring(), "INVEKLLEWSSARQ")
01334         self.assertEqual(motif.instances[5].tostring(), "IDTEKLLGYIMSQQ")
01335         self.assertEqual(motif.instances[6].tostring(), "FVKEEVISFVLSCW")
01336         self.assertEqual(motif.instances[7].tostring(), "INVDKVVAYVQSLQ")
01337         self.assertEqual(motif.instances[8].tostring(), "INREKLLQYLYSLK")
01338         self.assertEqual(motif.instances[9].tostring(), "FNKHALRDYILYCC")
01339         self.assertEqual(motif.instances[10].tostring(), "LDKRSLARFVSKCQ")
01340         self.assertEqual(motif.instances[11].tostring(), "LNLKSLLQWVTSRQ")
01341         self.assertEqual(motif.instances[12].tostring(), "DLFEGTAEWIARCQ")
01342         self.assertEqual(motif.instances[13].tostring(), "ELTEGVLNYLKNCQ")
01343         self.assertEqual(motif.instances[14].tostring(), "FHQQALQEYILMCC")
01344         self.assertEqual(motif.instances[15].tostring(), "KFKEDTITWLLHRQ")
01345         self.assertEqual(motif.instances[16].tostring(), "IVATDVCQFLELCQ")
01346         self.assertEqual(motif.instances[17].tostring(), "IPQEIFNDFSKRCC")
01347         self.assertEqual(motif.instances[18].tostring(), "DRKVRLISFIRGNQ")
01348         self.assertEqual(motif.instances[19].tostring(), "EVVDPAVDFVLKCY")
01349         self.assertEqual(motif.instances[20].tostring(), "IDRKGIYQWLISLK")
01350         handle.close()
01353 class TestMAST(unittest.TestCase):
01355     def test_mast_parser_1(self):
01356         """Test if Motif can parse MAST output files (first test)
01357         """
01358         from Bio.Alphabet import IUPAC
01359         from Bio.Motif.Parsers import MAST
01360         handle = open("Motif/mast.dna.oops.txt")
01361         record =
01362         self.assertEqual(record.version, "3.0")
01363         self.assertEqual(record.database, "INO_up800.s")
01364         self.assertEqual(record.alphabet, IUPAC.unambiguous_dna)
01365         self.assertEqual(len(record.motifs), 2)
01366         self.assertEqual(record.motifs[0].alphabet, IUPAC.unambiguous_dna)
01367         self.assertEqual(record.motifs[0].length, 12)
01368         self.assertEqual(record.motifs[0].name, "1")
01369         self.assertEqual(record.motifs[1].alphabet, IUPAC.unambiguous_dna)
01370         self.assertEqual(record.motifs[1].length, 10)
01371         self.assertEqual(record.motifs[1].name, "2")
01372         self.assertEqual(len(record.sequences), 7)
01373         self.assertEqual(record.sequences[0], "ACC1")
01374         self.assertEqual(record.sequences[1], "CHO1")
01375         self.assertEqual(record.sequences[2], "INO1")
01376         self.assertEqual(record.sequences[3], "FAS1")
01377         self.assertEqual(record.sequences[4], "OPI3")
01378         self.assertEqual(record.sequences[5], "CHO2")
01379         self.assertEqual(record.sequences[6], "FAS2")
01380         self.assertEqual(record.diagrams["ACC1"], "82_[+1]_137_[+2]_559")
01381         self.assertEqual(record.diagrams["CHO1"], "152_[+2]_396_[-2]_42_[+1]_17_[+1]_149")
01382         self.assertEqual(record.diagrams["INO1"], "282_[-2]_327_[-1]_55_[+1]_102")
01383         self.assertEqual(record.diagrams["FAS1"], "43_[+2]_41_[+1]_694")
01384         self.assertEqual(record.diagrams["OPI3"], "185_[-2]_144_[+1]_449")
01385         self.assertEqual(record.diagrams["CHO2"], "353_[+1]_47_[-2]_378")
01386         self.assertEqual(record.diagrams["FAS2"], "184_[-2]_372_[+1]_222")
01387         handle.close()
01389     def test_mast_parser_2(self):
01390         """Test if Motif can parse MAST output files (second test)
01391         """
01392         from Bio.Alphabet import IUPAC
01393         from Bio.Motif.Parsers import MAST
01394         handle = open("Motif/mast.protein.oops.txt")
01395         record =
01396         self.assertEqual(record.version, "3.0")
01397         self.assertEqual(record.database, "adh.s")
01398         self.assertEqual(record.alphabet, IUPAC.protein)
01399         self.assertEqual(len(record.motifs), 2)
01400         self.assertEqual(record.motifs[0].alphabet, IUPAC.protein)
01401         self.assertEqual(record.motifs[0].length, 29)
01402         self.assertEqual(record.motifs[0].name, "1")
01403         self.assertEqual(record.motifs[1].alphabet, IUPAC.protein)
01404         self.assertEqual(record.motifs[1].length, 29)
01405         self.assertEqual(record.motifs[1].name, "2")
01406         self.assertEqual(len(record.sequences), 33)
01407         self.assertEqual(record.sequences[0], "BUDC_KLETE")
01408         self.assertEqual(record.sequences[1], "YRTP_BACSU")
01409         self.assertEqual(record.sequences[2], "AP27_MOUSE")
01410         self.assertEqual(record.sequences[3], "HDE_CANTR")
01411         self.assertEqual(record.sequences[4], "HDHA_ECOLI")
01412         self.assertEqual(record.sequences[5], "DHII_HUMAN")
01413         self.assertEqual(record.sequences[6], "FIXR_BRAJA")
01414         self.assertEqual(record.sequences[7], "DHGB_BACME")
01415         self.assertEqual(record.sequences[8], "NODG_RHIME")
01416         self.assertEqual(record.sequences[9], "RIDH_KLEAE")
01417         self.assertEqual(record.sequences[10], "YINL_LISMO")
01418         self.assertEqual(record.sequences[11], "DHMA_FLAS1")
01419         self.assertEqual(record.sequences[12], "HMTR_LEIMA")
01420         self.assertEqual(record.sequences[13], "2BHD_STREX")
01421         self.assertEqual(record.sequences[14], "ENTA_ECOLI")
01422         self.assertEqual(record.sequences[15], "DHB2_HUMAN")
01423         self.assertEqual(record.sequences[16], "BDH_HUMAN")
01424         self.assertEqual(record.sequences[17], "BA72_EUBSP")
01425         self.assertEqual(record.sequences[18], "FVT1_HUMAN")
01426         self.assertEqual(record.sequences[19], "GUTD_ECOLI")
01427         self.assertEqual(record.sequences[20], "DHB3_HUMAN")
01428         self.assertEqual(record.sequences[21], "3BHD_COMTE")
01429         self.assertEqual(record.sequences[22], "LIGD_PSEPA")
01430         self.assertEqual(record.sequences[23], "DHES_HUMAN")
01431         self.assertEqual(record.sequences[24], "RFBB_NEIGO")
01432         self.assertEqual(record.sequences[25], "BPHB_PSEPS")
01433         self.assertEqual(record.sequences[26], "YURA_MYXXA")
01434         self.assertEqual(record.sequences[27], "PCR_PEA")
01435         self.assertEqual(record.sequences[28], "DHCA_HUMAN")
01436         self.assertEqual(record.sequences[29], "ADH_DROME")
01437         self.assertEqual(record.sequences[30], "MAS1_AGRRA")
01438         self.assertEqual(record.sequences[31], "FABI_ECOLI")
01439         self.assertEqual(record.sequences[32], "CSGA_MYXXA")
01440         self.assertEqual(record.diagrams["BUDC_KLETE"], "2_[2]_120_[1]_61")
01441         self.assertEqual(record.diagrams["YRTP_BACSU"], "6_[2]_119_[1]_55")
01442         self.assertEqual(record.diagrams["AP27_MOUSE"], "7_[2]_112_[1]_67")
01443         self.assertEqual(record.diagrams["HDE_CANTR"], "8_[2]_125_[1]_131_[2]_115_[1]_411")
01444         self.assertEqual(record.diagrams["HDHA_ECOLI"], "11_[2]_74_[1]_15_[1]_68")
01445         self.assertEqual(record.diagrams["DHII_HUMAN"], "34_[2]_119_[1]_81")
01446         self.assertEqual(record.diagrams["FIXR_BRAJA"], "36_[2]_123_[1]_61")
01447         self.assertEqual(record.diagrams["DHGB_BACME"], "7_[2]_123_[1]_74")
01448         self.assertEqual(record.diagrams["NODG_RHIME"], "6_[2]_116_[1]_65")
01449         self.assertEqual(record.diagrams["RIDH_KLEAE"], "14_[2]_116_[1]_61")
01450         self.assertEqual(record.diagrams["YINL_LISMO"], "5_[2]_75_[2]_15_[1]_66")
01451         self.assertEqual(record.diagrams["DHMA_FLAS1"], "14_[2]_121_[1]_77")
01452         self.assertEqual(record.diagrams["HMTR_LEIMA"], "6_[2]_157_[1]_66")
01453         self.assertEqual(record.diagrams["2BHD_STREX"], "6_[2]_116_[1]_75")
01454         self.assertEqual(record.diagrams["ENTA_ECOLI"], "5_[2]_109_[1]_76")
01455         self.assertEqual(record.diagrams["DHB2_HUMAN"], "82_[2]_120_[1]_127")
01456         self.assertEqual(record.diagrams["BDH_HUMAN"], "55_[2]_123_[1]_107")
01457         self.assertEqual(record.diagrams["BA72_EUBSP"], "6_[2]_121_[1]_64")
01458         self.assertEqual(record.diagrams["FVT1_HUMAN"], "32_[2]_124_[1]_118")
01459         self.assertEqual(record.diagrams["GUTD_ECOLI"], "2_[2]_122_[1]_77")
01460         self.assertEqual(record.diagrams["DHB3_HUMAN"], "48_[2]_120_[1]_84")
01461         self.assertEqual(record.diagrams["3BHD_COMTE"], "6_[2]_115_[1]_74")
01462         self.assertEqual(record.diagrams["LIGD_PSEPA"], "6_[2]_121_[1]_120")
01463         self.assertEqual(record.diagrams["DHES_HUMAN"], "2_[2]_50_[2]_44_[1]_144")
01464         self.assertEqual(record.diagrams["RFBB_NEIGO"], "6_[2]_129_[1]_153")
01465         self.assertEqual(record.diagrams["BPHB_PSEPS"], "5_[2]_118_[1]_94")
01466         self.assertEqual(record.diagrams["YURA_MYXXA"], "65_[2]_22_[2]_14_[1]_70")
01467         self.assertEqual(record.diagrams["PCR_PEA"], "25_[1]_32_[2]_284")
01468         self.assertEqual(record.diagrams["DHCA_HUMAN"], "4_[2]_159_[1]_55")
01469         self.assertEqual(record.diagrams["ADH_DROME"], "6_[2]_116_[1]_75")
01470         self.assertEqual(record.diagrams["MAS1_AGRRA"], "245_[2]_74_[1]_14_[1]_56")
01471         self.assertEqual(record.diagrams["FABI_ECOLI"], "6_[2]_123_[1]_75")
01472         self.assertEqual(record.diagrams["CSGA_MYXXA"], "51_[2]_7_[1]_50")
01473         handle.close()
01475     def test_mast_parser_3(self):
01476         """Test if Motif can parse MAST output files (third test)
01477         """
01478         from Bio.Alphabet import IUPAC
01479         from Bio.Motif.Parsers import MAST
01480         handle = open("Motif/mast.protein.tcm.txt")
01481         record =
01482         self.assertEqual(record.version, "3.0")
01483         self.assertEqual(record.database, "farntrans5.s")
01484         self.assertEqual(record.alphabet, IUPAC.protein)
01485         self.assertEqual(len(record.motifs), 2)
01486         self.assertEqual(record.motifs[0].alphabet, IUPAC.protein)
01487         self.assertEqual(record.motifs[0].length, 30)
01488         self.assertEqual(record.motifs[0].name, "1")
01489         self.assertEqual(record.motifs[1].alphabet, IUPAC.protein)
01490         self.assertEqual(record.motifs[1].length, 14)
01491         self.assertEqual(record.motifs[1].name, "2")
01492         self.assertEqual(len(record.sequences), 5)
01493         self.assertEqual(record.sequences[0], "BET2_YEAST")
01494         self.assertEqual(record.sequences[1], "RATRABGERB")
01495         self.assertEqual(record.sequences[2], "CAL1_YEAST")
01496         self.assertEqual(record.sequences[3], "PFTB_RAT")
01497         self.assertEqual(record.sequences[4], "RAM1_YEAST")
01498         self.assertEqual(record.diagrams["BET2_YEAST"], "6_[2]_3_[1]_1_[2]_4_[1]_4_[2]_3_[1]_1_[2]_3_[1]_21_[1]_1_[2]_4_[1]_24")
01499         self.assertEqual(record.diagrams["RATRABGERB"], "65_[2]_3_[1]_1_[2]_3_[1]_1_[2]_3_[1]_18_[1]_1_[2]_4_[1]_26")
01500         self.assertEqual(record.diagrams["CAL1_YEAST"], "125_[2]_50_[2]_1_[1]_4_[2]_22_[1]_22_[1]_5_[2]_1")
01501         self.assertEqual(record.diagrams["PFTB_RAT"], "120_[2]_3_[1]_4_[2]_3_[1]_1_[2]_3_[1]_1_[2]_4_[1]_14_[2]_4_[1]_60")
01502         self.assertEqual(record.diagrams["RAM1_YEAST"], "144_[1]_5_[2]_4_[1]_1_[2]_4_[1]_1_[2]_4_[1]_4_[2]_5_[1]_35_[2]_4")
01503         handle.close()
01506 class MotifTestPWM(unittest.TestCase):
01507     def setUp(self):
01508         handle = open("Motif/SRF.pfm")
01509         self.m =, "jaspar-pfm")
01510         handle.close()
01511         self.s = Seq("ACGTGTGCGTAGTGCGT", self.m.alphabet)
01513     def test_simple(self):
01514         """Test if Motif PWM scoring works."""
01515         result = self.m.scanPWM(self.s)
01516         self.assertEqual(6, len(result))
01517         # The fast C-code in Bio/Motif/_pwm.c stores all results as 32-bit
01518         # floats; the slower Python code in Bio/Motif/ uses 64-bit
01519         # doubles. The C-code and Python code results will therefore not be
01520         # exactly equal. Test the first 5 decimal places only to avoid either
01521         # the C-code or the Python code to inadvertently fail this test.
01522         self.assertAlmostEqual(result[0], -29.18363571, places=5)
01523         self.assertAlmostEqual(result[1], -38.3365097, places=5)
01524         self.assertAlmostEqual(result[2], -29.17756271, places=5)
01525         self.assertAlmostEqual(result[3], -38.04542542, places=5)
01526         self.assertAlmostEqual(result[4], -20.3014183, places=5)
01527         self.assertAlmostEqual(result[5], -25.18009186, places=5)
01530 if __name__ == "__main__":
01531     runner = unittest.TextTestRunner(verbosity = 2)
01532     unittest.main(testRunner=runner)