Back to index

python-biopython  1.60
test_IsoelectricPoint.py
Go to the documentation of this file.
00001 from Bio.SeqUtils import ProtParam
00002 
00003 X = ProtParam.ProteinAnalysis("MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTSGLLYGSQTPSEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV")
00004 print "isoelectric point for this protein: %.3f" % X.isoelectric_point()