Back to index

python-biopython  1.60
Public Member Functions | Public Attributes | Static Public Attributes | Private Member Functions
test_NCBITextParser.TestNCBITextParser Class Reference
Collaboration diagram for test_NCBITextParser.TestNCBITextParser:
Collaboration graph
[legend]

List of all members.

Public Member Functions

def setUp
def test_bt001
def test_bt002
def test_bt003
def test_bt004
def test_bt005
def test_bt006
def test_bt007
def test_bt009
def test_bt010
def test_bt011
def test_bt012
def test_bt013
def test_bt014
def test_bt015
def test_bt016
def test_bt017
def test_bt018
def test_bt039
def test_bt040
def test_bt041
def test_bt042
def test_bt043
def test_bt044
def test_bt045
def test_bt046
def test_bt047
def test_bt048
def test_bt049
def test_bt050
def test_bt051
def test_bt052
def test_bt053
def test_bt054
def test_bt055
def test_bt056
def test_bt057
def test_bt058
def test_bt059
def test_bt060
def test_bt062
def test_bt063
def test_bt067
def test_bt068
def test_bt069
def test_bt070
def test_bt071
def test_bt075
def test_bt076
def test_bt077
def test_bt078
def test_bt079
def test_bt080
def test_bt081
def test_bt082
def test_bt083
def test_bt084
def test_bt085
def test_bt086
def test_bt087
def test_bt088
def test_bt089
def test_bt090
def test_bt091
def test_bt092
def test_bt093
def test_bt094
def test_bt095
def test_bt096

Public Attributes

 parser
 pb_parser

Static Public Attributes

string reference = 'Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, \nJinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), \n"Gapped BLAST and PSI-BLAST: a new generation of protein database search\nprograms", Nucleic Acids Res. 25:3389-3402.'

Private Member Functions

def _check_bt007_round0
def _check_bt007_round1
def _check_bt007_round2
def _check_bt007_hsps
def _check_bt007_hsps_details
def _check_bt007_footer
def _check_bt009_round0
def _check_bt009_round1
def _check_bt009_hsps
def _check_bt009_hsps_details
def _check_bt009_footer
def _check_bt047_round0
def _check_bt047_round1
def _check_bt047_hsps
def _check_bt047_hsps_details
def _check_bt047_footer
def _check_bt060_round0
def _check_bt060_round1
def _check_bt060_round2
def _check_bt060_round3
def _check_bt060_round4
def _check_bt060_hsps
def _check_bt060_hsps_counts
def _check_bt060_hsps_details
def _check_bt060_footer

Detailed Description

Definition at line 34 of file test_NCBITextParser.py.


Member Function Documentation

def test_NCBITextParser.TestNCBITextParser._check_bt007_footer (   self,
  record 
) [private]

Definition at line 1870 of file test_NCBITextParser.py.

01870 
01871     def _check_bt007_footer(self, record):
01872         self.assertEqual(record.database_name, ['data/swissprot'])
01873         self.assertEqual(record.num_letters_in_database, [29652561])
01874         self.assertEqual(record.num_sequences_in_database, [82258])
01875         self.assertEqual(record.posted_date, [('Nov 15, 1999  2:55 PM',)])
01876         self.assertEqual(len(record.ka_params), 3)
01877         self.assertAlmostEqual(record.ka_params[0], 0.319)
01878         self.assertAlmostEqual(record.ka_params[1], 0.118)
01879         self.assertAlmostEqual(record.ka_params[2], 0.300)
01880         self.assertEqual(len(record.ka_params_gap), 3)
01881         self.assertAlmostEqual(record.ka_params_gap[0], 0.270)
01882         self.assertAlmostEqual(record.ka_params_gap[1], 0.0413)
01883         self.assertAlmostEqual(record.ka_params_gap[2], 0.230)
01884         self.assertEqual(record.matrix, 'BLOSUM62')
01885         self.assertEqual(record.gap_penalties, [11,1])
01886         self.assertEqual(record.num_hits, 51436041)
01887         self.assertEqual(record.num_sequences, 82258)
01888         self.assertEqual(record.num_extends, 1847150)
01889         self.assertEqual(record.num_good_extends, 5653)
01890         self.assertEqual(record.num_seqs_better_e, 61)
01891         self.assertEqual(record.hsps_no_gap, 21)
01892         self.assertEqual(record.hsps_prelim_gapped, 40)
01893         self.assertEqual(record.hsps_gapped, 65)
01894         self.assertEqual(record.query_length, 369)
01895         self.assertEqual(record.database_length, 29652561)
01896         self.assertEqual(record.effective_hsp_length, 53)
01897         self.assertEqual(record.effective_query_length, 316)
01898         self.assertEqual(record.effective_database_length, 25292887)
01899         self.assertEqual(record.effective_search_space, 7992552292)
01900         self.assertEqual(record.effective_search_space_used, 7992552292)
01901         self.assertEqual(record.threshold, 11)
01902         self.assertEqual(record.window_size, 40)
01903         self.assertEqual(len(record.dropoff_1st_pass), 2)
01904         self.assertEqual(record.dropoff_1st_pass[0], 16)
01905         self.assertAlmostEqual(record.dropoff_1st_pass[1], 7.4)
01906         self.assertEqual(len(record.gap_x_dropoff), 2)
01907         self.assertEqual(record.gap_x_dropoff[0], 38)
01908         self.assertAlmostEqual(record.gap_x_dropoff[1], 14.8)
01909         self.assertEqual(len(record.gap_x_dropoff_final), 2)
01910         self.assertEqual(record.gap_x_dropoff_final[0], 64)
01911         self.assertAlmostEqual(record.gap_x_dropoff_final[1], 24.9)
01912         self.assertEqual(len(record.gap_trigger), 2)
01913         self.assertEqual(record.gap_trigger[0], 41)
01914         self.assertAlmostEqual(record.gap_trigger[1], 21.9)
01915         self.assertEqual(len(record.blast_cutoff), 2)
01916         self.assertEqual(record.blast_cutoff[0], 65)
01917         self.assertAlmostEqual(record.blast_cutoff[1], 29.9)

Here is the caller graph for this function:

def test_NCBITextParser.TestNCBITextParser._check_bt007_hsps (   self,
  record 
) [private]

Definition at line 1023 of file test_NCBITextParser.py.

01023 
01024     def _check_bt007_hsps(self, record):
01025         self.assertEqual(record.rounds[0].alignments[0].hsps[0].score, 1897)
01026         self.assertAlmostEqual(record.rounds[0].alignments[0].hsps[0].bits, 743)
01027         self.assertAlmostEqual(record.rounds[0].alignments[0].hsps[0].expect, 0.0)
01028         self.assertEqual(len(record.rounds[0].alignments[0].hsps), 1)
01029         self.assertEqual(record.rounds[0].alignments[1].hsps[0].score, 1733)
01030         self.assertAlmostEqual(record.rounds[0].alignments[1].hsps[0].bits, 679)
01031         self.assertAlmostEqual(record.rounds[0].alignments[1].hsps[0].expect, 0.0)
01032         self.assertEqual(len(record.rounds[0].alignments[1].hsps), 1)
01033         self.assertEqual(record.rounds[0].alignments[2].hsps[0].score, 1482)
01034         self.assertAlmostEqual(record.rounds[0].alignments[2].hsps[0].bits, 581)
01035         self.assertAlmostEqual(record.rounds[0].alignments[2].hsps[0].expect, 1e-166)
01036         self.assertEqual(len(record.rounds[0].alignments[2].hsps), 1)
01037         self.assertEqual(record.rounds[0].alignments[3].hsps[0].score, 1470)
01038         self.assertAlmostEqual(record.rounds[0].alignments[3].hsps[0].bits, 577)
01039         self.assertAlmostEqual(record.rounds[0].alignments[3].hsps[0].expect, 1e-164)
01040         self.assertEqual(len(record.rounds[0].alignments[3].hsps), 1)
01041         self.assertEqual(record.rounds[0].alignments[4].hsps[0].score, 1453)
01042         self.assertAlmostEqual(record.rounds[0].alignments[4].hsps[0].bits, 570)
01043         self.assertAlmostEqual(record.rounds[0].alignments[4].hsps[0].expect, 1e-162)
01044         self.assertEqual(len(record.rounds[0].alignments[4].hsps), 1)
01045         self.assertEqual(record.rounds[0].alignments[5].hsps[0].score, 1050)
01046         self.assertAlmostEqual(record.rounds[0].alignments[5].hsps[0].bits, 413)
01047         self.assertAlmostEqual(record.rounds[0].alignments[5].hsps[0].expect, 1e-115)
01048         self.assertEqual(len(record.rounds[0].alignments[5].hsps), 1)
01049         self.assertEqual(record.rounds[0].alignments[6].hsps[0].score, 92)
01050         self.assertAlmostEqual(record.rounds[0].alignments[6].hsps[0].bits, 40.2)
01051         self.assertAlmostEqual(record.rounds[0].alignments[6].hsps[0].expect, 0.006)
01052         self.assertEqual(len(record.rounds[0].alignments[6].hsps), 1)
01053         self.assertEqual(record.rounds[0].alignments[7].hsps[0].score, 72)
01054         self.assertAlmostEqual(record.rounds[0].alignments[7].hsps[0].bits, 32.5)
01055         self.assertAlmostEqual(record.rounds[0].alignments[7].hsps[0].expect, 1.4)
01056         self.assertEqual(len(record.rounds[0].alignments[7].hsps), 1)
01057         self.assertEqual(record.rounds[0].alignments[8].hsps[0].score, 71)
01058         self.assertAlmostEqual(record.rounds[0].alignments[8].hsps[0].bits, 32.1)
01059         self.assertAlmostEqual(record.rounds[0].alignments[8].hsps[0].expect, 1.8)
01060         self.assertEqual(len(record.rounds[0].alignments[8].hsps), 1)
01061         self.assertEqual(record.rounds[0].alignments[9].hsps[0].score, 71)
01062         self.assertAlmostEqual(record.rounds[0].alignments[9].hsps[0].bits, 32.1)
01063         self.assertAlmostEqual(record.rounds[0].alignments[9].hsps[0].expect, 1.8)
01064         self.assertEqual(len(record.rounds[0].alignments[9].hsps), 1)
01065         self.assertEqual(record.rounds[0].alignments[10].hsps[0].score, 71)
01066         self.assertAlmostEqual(record.rounds[0].alignments[10].hsps[0].bits, 32.1)
01067         self.assertAlmostEqual(record.rounds[0].alignments[10].hsps[0].expect, 1.8)
01068         self.assertEqual(len(record.rounds[0].alignments[10].hsps), 1)
01069         self.assertEqual(record.rounds[0].alignments[11].hsps[0].score, 68)
01070         self.assertAlmostEqual(record.rounds[0].alignments[11].hsps[0].bits, 30.9)
01071         self.assertAlmostEqual(record.rounds[0].alignments[11].hsps[0].expect, 4.0)
01072         self.assertEqual(len(record.rounds[0].alignments[11].hsps), 1)
01073         self.assertEqual(record.rounds[0].alignments[12].hsps[0].score, 68)
01074         self.assertAlmostEqual(record.rounds[0].alignments[12].hsps[0].bits, 30.9)
01075         self.assertAlmostEqual(record.rounds[0].alignments[12].hsps[0].expect, 4.0)
01076         self.assertEqual(len(record.rounds[0].alignments[12].hsps), 1)
01077         self.assertEqual(record.rounds[0].alignments[13].hsps[0].score, 67)
01078         self.assertAlmostEqual(record.rounds[0].alignments[13].hsps[0].bits, 30.5)
01079         self.assertAlmostEqual(record.rounds[0].alignments[13].hsps[0].expect, 5.2)
01080         self.assertEqual(record.rounds[1].alignments[0].hsps[0].score, 1683)
01081         self.assertAlmostEqual(record.rounds[1].alignments[0].hsps[0].bits, 660)
01082         self.assertAlmostEqual(record.rounds[1].alignments[0].hsps[0].expect, 0.0)
01083         self.assertEqual(len(record.rounds[1].alignments[0].hsps), 1)
01084         self.assertEqual(record.rounds[1].alignments[1].hsps[0].score, 1673)
01085         self.assertAlmostEqual(record.rounds[1].alignments[1].hsps[0].bits, 656)
01086         self.assertAlmostEqual(record.rounds[1].alignments[1].hsps[0].expect, 0.0)
01087         self.assertEqual(len(record.rounds[1].alignments[1].hsps), 1)
01088         self.assertEqual(record.rounds[1].alignments[2].hsps[0].score, 1672)
01089         self.assertAlmostEqual(record.rounds[1].alignments[2].hsps[0].bits, 655)
01090         self.assertAlmostEqual(record.rounds[1].alignments[2].hsps[0].expect, 0.0)
01091         self.assertEqual(len(record.rounds[1].alignments[2].hsps), 1)
01092         self.assertEqual(record.rounds[1].alignments[3].hsps[0].score, 1671)
01093         self.assertAlmostEqual(record.rounds[1].alignments[3].hsps[0].bits, 655)
01094         self.assertAlmostEqual(record.rounds[1].alignments[3].hsps[0].expect, 0.0)
01095         self.assertEqual(len(record.rounds[1].alignments[3].hsps), 1)
01096         self.assertEqual(record.rounds[1].alignments[4].hsps[0].score, 1670)
01097         self.assertAlmostEqual(record.rounds[1].alignments[4].hsps[0].bits, 655)
01098         self.assertAlmostEqual(record.rounds[1].alignments[4].hsps[0].expect, 0.0)
01099         self.assertEqual(len(record.rounds[1].alignments[4].hsps), 1)
01100         self.assertEqual(record.rounds[1].alignments[5].hsps[0].score, 1569)
01101         self.assertAlmostEqual(record.rounds[1].alignments[5].hsps[0].bits, 615)
01102         self.assertAlmostEqual(record.rounds[1].alignments[5].hsps[0].expect, 1e-176)
01103         self.assertEqual(len(record.rounds[1].alignments[5].hsps), 1)
01104         self.assertEqual(record.rounds[1].alignments[6].hsps[0].score, 113)
01105         self.assertAlmostEqual(record.rounds[1].alignments[6].hsps[0].bits, 48.6)
01106         self.assertAlmostEqual(record.rounds[1].alignments[6].hsps[0].expect, 2e-5)
01107         self.assertEqual(len(record.rounds[1].alignments[6].hsps), 1)
01108         self.assertEqual(record.rounds[1].alignments[7].hsps[0].score, 94)
01109         self.assertAlmostEqual(record.rounds[1].alignments[7].hsps[0].bits, 41.2)
01110         self.assertAlmostEqual(record.rounds[1].alignments[7].hsps[0].expect, 0.003)
01111         self.assertEqual(len(record.rounds[1].alignments[7].hsps), 1)
01112         self.assertEqual(record.rounds[1].alignments[8].hsps[0].score, 89)
01113         self.assertAlmostEqual(record.rounds[1].alignments[8].hsps[0].bits, 39.2)
01114         self.assertAlmostEqual(record.rounds[1].alignments[8].hsps[0].expect, 0.012)
01115         self.assertEqual(len(record.rounds[1].alignments[8].hsps), 1)
01116         self.assertEqual(record.rounds[1].alignments[9].hsps[0].score, 89)
01117         self.assertAlmostEqual(record.rounds[1].alignments[9].hsps[0].bits, 39.2)
01118         self.assertAlmostEqual(record.rounds[1].alignments[9].hsps[0].expect, 0.012)
01119         self.assertEqual(len(record.rounds[1].alignments[9].hsps), 1)
01120         self.assertEqual(record.rounds[1].alignments[10].hsps[0].score, 81)
01121         self.assertAlmostEqual(record.rounds[1].alignments[10].hsps[0].bits, 36.1)
01122         self.assertAlmostEqual(record.rounds[1].alignments[10].hsps[0].expect, 0.11)
01123         self.assertEqual(len(record.rounds[1].alignments[10].hsps), 1)
01124         self.assertEqual(record.rounds[1].alignments[11].hsps[0].score, 80)
01125         self.assertAlmostEqual(record.rounds[1].alignments[11].hsps[0].bits, 35.7)
01126         self.assertAlmostEqual(record.rounds[1].alignments[11].hsps[0].expect, 0.14)
01127         self.assertEqual(len(record.rounds[1].alignments[11].hsps), 1)
01128         self.assertEqual(record.rounds[1].alignments[12].hsps[0].score, 79)
01129         self.assertAlmostEqual(record.rounds[1].alignments[12].hsps[0].bits, 35.3)
01130         self.assertAlmostEqual(record.rounds[1].alignments[12].hsps[0].expect, 0.18)
01131         self.assertEqual(len(record.rounds[1].alignments[12].hsps), 1)
01132         self.assertEqual(record.rounds[1].alignments[13].hsps[0].score, 74)
01133         self.assertAlmostEqual(record.rounds[1].alignments[13].hsps[0].bits, 33.4)
01134         self.assertAlmostEqual(record.rounds[1].alignments[13].hsps[0].expect, 0.71)
01135         self.assertEqual(len(record.rounds[1].alignments[13].hsps), 1)
01136         self.assertEqual(record.rounds[1].alignments[14].hsps[0].score, 71)
01137         self.assertAlmostEqual(record.rounds[1].alignments[14].hsps[0].bits, 32.2)
01138         self.assertAlmostEqual(record.rounds[1].alignments[14].hsps[0].expect, 1.6)
01139         self.assertEqual(len(record.rounds[1].alignments[14].hsps), 1)
01140         self.assertEqual(record.rounds[1].alignments[15].hsps[0].score, 68)
01141         self.assertAlmostEqual(record.rounds[1].alignments[15].hsps[0].bits, 31.1)
01142         self.assertAlmostEqual(record.rounds[1].alignments[15].hsps[0].expect, 3.6)
01143         self.assertEqual(len(record.rounds[1].alignments[15].hsps), 1)
01144         self.assertEqual(record.rounds[1].alignments[16].hsps[0].score, 68)
01145         self.assertAlmostEqual(record.rounds[1].alignments[16].hsps[0].bits, 31.1)
01146         self.assertAlmostEqual(record.rounds[1].alignments[16].hsps[0].expect, 3.6)
01147         self.assertEqual(len(record.rounds[1].alignments[16].hsps), 1)
01148         self.assertEqual(record.rounds[1].alignments[17].hsps[0].score, 68)
01149         self.assertAlmostEqual(record.rounds[1].alignments[17].hsps[0].bits, 31.1)
01150         self.assertAlmostEqual(record.rounds[1].alignments[17].hsps[0].expect, 3.6)
01151         self.assertEqual(len(record.rounds[1].alignments[17].hsps), 1)
01152         self.assertEqual(record.rounds[1].alignments[18].hsps[0].score, 66)
01153         self.assertAlmostEqual(record.rounds[1].alignments[18].hsps[0].bits, 30.3)
01154         self.assertAlmostEqual(record.rounds[1].alignments[18].hsps[0].expect, 6.2)
01155         self.assertEqual(len(record.rounds[1].alignments[18].hsps), 1)
01156         self.assertEqual(record.rounds[1].alignments[19].hsps[0].score, 65)
01157         self.assertAlmostEqual(record.rounds[1].alignments[19].hsps[0].bits, 29.9)
01158         self.assertAlmostEqual(record.rounds[1].alignments[19].hsps[0].expect, 8.1)
01159         self.assertEqual(len(record.rounds[1].alignments[19].hsps), 1)
01160         self.assertEqual(record.rounds[1].alignments[20].hsps[0].score, 65)
01161         self.assertAlmostEqual(record.rounds[1].alignments[20].hsps[0].bits, 29.9)
01162         self.assertAlmostEqual(record.rounds[1].alignments[20].hsps[0].expect, 8.1)
01163         self.assertEqual(len(record.rounds[1].alignments[20].hsps), 1)
01164         self.assertEqual(record.rounds[1].alignments[21].hsps[0].score, 65)
01165         self.assertAlmostEqual(record.rounds[1].alignments[21].hsps[0].bits, 29.9)
01166         self.assertAlmostEqual(record.rounds[1].alignments[21].hsps[0].expect, 8.1)
01167         self.assertEqual(len(record.rounds[1].alignments[21].hsps), 1)
01168         self.assertEqual(record.rounds[1].alignments[22].hsps[0].score, 65)
01169         self.assertAlmostEqual(record.rounds[1].alignments[22].hsps[0].bits, 29.9)
01170         self.assertAlmostEqual(record.rounds[1].alignments[22].hsps[0].expect, 8.1)
01171         self.assertEqual(len(record.rounds[1].alignments[22].hsps), 1)
01172         self.assertEqual(record.rounds[1].alignments[23].hsps[0].score, 65)
01173         self.assertAlmostEqual(record.rounds[1].alignments[23].hsps[0].bits, 29.9)
01174         self.assertAlmostEqual(record.rounds[1].alignments[23].hsps[0].expect, 8.1)
01175         self.assertEqual(record.rounds[2].alignments[0].hsps[0].score, 1478)
01176         self.assertAlmostEqual(record.rounds[2].alignments[0].hsps[0].bits, 580)
01177         self.assertAlmostEqual(record.rounds[2].alignments[0].hsps[0].expect, 1e-165)
01178         self.assertEqual(len(record.rounds[2].alignments[0].hsps), 1)
01179         self.assertEqual(record.rounds[2].alignments[1].hsps[0].score, 1477)
01180         self.assertAlmostEqual(record.rounds[2].alignments[1].hsps[0].bits, 579)
01181         self.assertAlmostEqual(record.rounds[2].alignments[1].hsps[0].expect, 1e-165)
01182         self.assertEqual(len(record.rounds[2].alignments[1].hsps), 1)
01183         self.assertEqual(record.rounds[2].alignments[2].hsps[0].score, 1475)
01184         self.assertAlmostEqual(record.rounds[2].alignments[2].hsps[0].bits, 579)
01185         self.assertAlmostEqual(record.rounds[2].alignments[2].hsps[0].expect, 1e-165)
01186         self.assertEqual(len(record.rounds[2].alignments[2].hsps), 1)
01187         self.assertEqual(record.rounds[2].alignments[3].hsps[0].score, 1474)
01188         self.assertAlmostEqual(record.rounds[2].alignments[3].hsps[0].bits, 578)
01189         self.assertAlmostEqual(record.rounds[2].alignments[3].hsps[0].expect, 1e-165)
01190         self.assertEqual(len(record.rounds[2].alignments[3].hsps), 1)
01191         self.assertEqual(record.rounds[2].alignments[4].hsps[0].score, 1472)
01192         self.assertAlmostEqual(record.rounds[2].alignments[4].hsps[0].bits, 577)
01193         self.assertAlmostEqual(record.rounds[2].alignments[4].hsps[0].expect, 1e-165)
01194         self.assertEqual(len(record.rounds[2].alignments[4].hsps), 1)
01195         self.assertEqual(record.rounds[2].alignments[5].hsps[0].score, 1351)
01196         self.assertAlmostEqual(record.rounds[2].alignments[5].hsps[0].bits, 530)
01197         self.assertAlmostEqual(record.rounds[2].alignments[5].hsps[0].expect, 1e-150)
01198         self.assertEqual(len(record.rounds[2].alignments[5].hsps), 1)
01199         self.assertEqual(record.rounds[2].alignments[6].hsps[0].score, 976)
01200         self.assertAlmostEqual(record.rounds[2].alignments[6].hsps[0].bits, 384)
01201         self.assertAlmostEqual(record.rounds[2].alignments[6].hsps[0].expect, 1e-106)
01202         self.assertEqual(len(record.rounds[2].alignments[6].hsps), 1)
01203         self.assertEqual(record.rounds[2].alignments[7].hsps[0].score, 95)
01204         self.assertAlmostEqual(record.rounds[2].alignments[7].hsps[0].bits, 41.6)
01205         self.assertAlmostEqual(record.rounds[2].alignments[7].hsps[0].expect, 0.002)
01206         self.assertEqual(len(record.rounds[2].alignments[7].hsps), 1)
01207         self.assertEqual(record.rounds[2].alignments[8].hsps[0].score, 89)
01208         self.assertAlmostEqual(record.rounds[2].alignments[8].hsps[0].bits, 39.3)
01209         self.assertAlmostEqual(record.rounds[2].alignments[8].hsps[0].expect, 0.012)
01210         self.assertEqual(len(record.rounds[2].alignments[8].hsps), 1)
01211         self.assertEqual(record.rounds[2].alignments[9].hsps[0].score, 87)
01212         self.assertAlmostEqual(record.rounds[2].alignments[9].hsps[0].bits, 38.5)
01213         self.assertAlmostEqual(record.rounds[2].alignments[9].hsps[0].expect, 0.021)
01214         self.assertEqual(len(record.rounds[2].alignments[9].hsps), 1)
01215         self.assertEqual(record.rounds[2].alignments[10].hsps[0].score, 85)
01216         self.assertAlmostEqual(record.rounds[2].alignments[10].hsps[0].bits, 37.7)
01217         self.assertAlmostEqual(record.rounds[2].alignments[10].hsps[0].expect, 0.036)
01218         self.assertEqual(len(record.rounds[2].alignments[10].hsps), 1)
01219         self.assertEqual(record.rounds[2].alignments[11].hsps[0].score, 84)
01220         self.assertAlmostEqual(record.rounds[2].alignments[11].hsps[0].bits, 37.3)
01221         self.assertAlmostEqual(record.rounds[2].alignments[11].hsps[0].expect, 0.047)
01222         self.assertEqual(len(record.rounds[2].alignments[11].hsps), 1)
01223         self.assertEqual(record.rounds[2].alignments[12].hsps[0].score, 81)
01224         self.assertAlmostEqual(record.rounds[2].alignments[12].hsps[0].bits, 36.1)
01225         self.assertAlmostEqual(record.rounds[2].alignments[12].hsps[0].expect, 0.10)
01226         self.assertEqual(len(record.rounds[2].alignments[12].hsps), 1)
01227         self.assertEqual(record.rounds[2].alignments[13].hsps[0].score, 81)
01228         self.assertAlmostEqual(record.rounds[2].alignments[13].hsps[0].bits, 36.1)
01229         self.assertAlmostEqual(record.rounds[2].alignments[13].hsps[0].expect, 0.10)
01230         self.assertEqual(len(record.rounds[2].alignments[13].hsps), 1)
01231         self.assertEqual(record.rounds[2].alignments[14].hsps[0].score, 79)
01232         self.assertAlmostEqual(record.rounds[2].alignments[14].hsps[0].bits, 35.4)
01233         self.assertAlmostEqual(record.rounds[2].alignments[14].hsps[0].expect, 0.18)
01234         self.assertEqual(len(record.rounds[2].alignments[14].hsps), 1)
01235         self.assertEqual(record.rounds[2].alignments[15].hsps[0].score, 74)
01236         self.assertAlmostEqual(record.rounds[2].alignments[15].hsps[0].bits, 33.4)
01237         self.assertAlmostEqual(record.rounds[2].alignments[15].hsps[0].expect, 0.69)
01238         self.assertEqual(len(record.rounds[2].alignments[15].hsps), 1)
01239         self.assertEqual(record.rounds[2].alignments[16].hsps[0].score, 74)
01240         self.assertAlmostEqual(record.rounds[2].alignments[16].hsps[0].bits, 33.4)
01241         self.assertAlmostEqual(record.rounds[2].alignments[16].hsps[0].expect, 0.69)
01242         self.assertEqual(len(record.rounds[2].alignments[16].hsps), 1)
01243         self.assertEqual(record.rounds[2].alignments[17].hsps[0].score, 73)
01244         self.assertAlmostEqual(record.rounds[2].alignments[17].hsps[0].bits, 33.0)
01245         self.assertAlmostEqual(record.rounds[2].alignments[17].hsps[0].expect, 0.91)
01246         self.assertEqual(len(record.rounds[2].alignments[17].hsps), 1)
01247         self.assertEqual(record.rounds[2].alignments[18].hsps[0].score, 73)
01248         self.assertAlmostEqual(record.rounds[2].alignments[18].hsps[0].bits, 33.0)
01249         self.assertAlmostEqual(record.rounds[2].alignments[18].hsps[0].expect, 0.91)
01250         self.assertEqual(len(record.rounds[2].alignments[18].hsps), 1)
01251         self.assertEqual(record.rounds[2].alignments[19].hsps[0].score, 70)
01252         self.assertAlmostEqual(record.rounds[2].alignments[19].hsps[0].bits, 31.9)
01253         self.assertAlmostEqual(record.rounds[2].alignments[19].hsps[0].expect, 2.0)
01254         self.assertEqual(len(record.rounds[2].alignments[19].hsps), 1)
01255         self.assertEqual(record.rounds[2].alignments[20].hsps[0].score, 70)
01256         self.assertAlmostEqual(record.rounds[2].alignments[20].hsps[0].bits, 31.9)
01257         self.assertAlmostEqual(record.rounds[2].alignments[20].hsps[0].expect, 2.0)
01258         self.assertEqual(len(record.rounds[2].alignments[20].hsps), 1)
01259         self.assertEqual(record.rounds[2].alignments[21].hsps[0].score, 69)
01260         self.assertAlmostEqual(record.rounds[2].alignments[21].hsps[0].bits, 31.5)
01261         self.assertAlmostEqual(record.rounds[2].alignments[21].hsps[0].expect, 2.7)
01262         self.assertEqual(len(record.rounds[2].alignments[21].hsps), 1)
01263         self.assertEqual(record.rounds[2].alignments[22].hsps[0].score, 68)
01264         self.assertAlmostEqual(record.rounds[2].alignments[22].hsps[0].bits, 31.1)
01265         self.assertAlmostEqual(record.rounds[2].alignments[22].hsps[0].expect, 3.5)
01266         self.assertEqual(len(record.rounds[2].alignments[22].hsps), 1)
01267         self.assertEqual(record.rounds[0].alignments[0].hsps[0].identities, (369, 369))
01268         self.assertEqual(record.rounds[0].alignments[0].hsps[0].positives, (369, 369))
01269         self.assertEqual(record.rounds[0].alignments[1].hsps[0].identities, (333, 369))
01270         self.assertEqual(record.rounds[0].alignments[1].hsps[0].positives, (351, 369))
01271         self.assertEqual(record.rounds[0].alignments[2].hsps[0].identities, (282, 369))
01272         self.assertEqual(record.rounds[0].alignments[2].hsps[0].positives, (320, 369))
01273         self.assertEqual(record.rounds[0].alignments[2].hsps[0].gaps, (2, 369))
01274         self.assertEqual(record.rounds[0].alignments[3].hsps[0].identities, (280, 366))
01275         self.assertEqual(record.rounds[0].alignments[3].hsps[0].positives, (316, 366))
01276         self.assertEqual(record.rounds[0].alignments[3].hsps[0].gaps, (2, 366))
01277         self.assertEqual(record.rounds[0].alignments[4].hsps[0].identities, (276, 369))
01278         self.assertEqual(record.rounds[0].alignments[4].hsps[0].positives, (316, 369))
01279         self.assertEqual(record.rounds[0].alignments[4].hsps[0].gaps, (2, 369))
01280         self.assertEqual(record.rounds[0].alignments[5].hsps[0].identities, (193, 368))
01281         self.assertEqual(record.rounds[0].alignments[5].hsps[0].positives, (268, 368))
01282         self.assertEqual(record.rounds[0].alignments[6].hsps[0].identities, (60, 334))
01283         self.assertEqual(record.rounds[0].alignments[6].hsps[0].positives, (130, 334))
01284         self.assertEqual(record.rounds[0].alignments[6].hsps[0].gaps, (23, 334))
01285         self.assertEqual(record.rounds[0].alignments[7].hsps[0].identities, (18, 67))
01286         self.assertEqual(record.rounds[0].alignments[7].hsps[0].positives, (32, 67))
01287         self.assertEqual(record.rounds[0].alignments[7].hsps[0].gaps, (2, 67))
01288         self.assertEqual(record.rounds[0].alignments[8].hsps[0].identities, (28, 89))
01289         self.assertEqual(record.rounds[0].alignments[8].hsps[0].positives, (42, 89))
01290         self.assertEqual(record.rounds[0].alignments[8].hsps[0].gaps, (11, 89))
01291         self.assertEqual(record.rounds[0].alignments[9].hsps[0].identities, (29, 125))
01292         self.assertEqual(record.rounds[0].alignments[9].hsps[0].positives, (57, 125))
01293         self.assertEqual(record.rounds[0].alignments[9].hsps[0].gaps, (6, 125))
01294         self.assertEqual(record.rounds[0].alignments[10].hsps[0].identities, (24, 93))
01295         self.assertEqual(record.rounds[0].alignments[10].hsps[0].positives, (44, 93))
01296         self.assertEqual(record.rounds[0].alignments[10].hsps[0].gaps, (2, 93))
01297         self.assertEqual(record.rounds[0].alignments[11].hsps[0].identities, (24, 65))
01298         self.assertEqual(record.rounds[0].alignments[11].hsps[0].positives, (31, 65))
01299         self.assertEqual(record.rounds[0].alignments[11].hsps[0].gaps, (9, 65))
01300         self.assertEqual(record.rounds[0].alignments[12].hsps[0].identities, (18, 55))
01301         self.assertEqual(record.rounds[0].alignments[12].hsps[0].positives, (31, 55))
01302         self.assertEqual(record.rounds[0].alignments[12].hsps[0].gaps, (1, 55))
01303         self.assertEqual(record.rounds[0].alignments[13].hsps[0].identities, (24, 90))
01304         self.assertEqual(record.rounds[0].alignments[13].hsps[0].positives, (41, 90))
01305         self.assertEqual(record.rounds[0].alignments[13].hsps[0].gaps, (10, 90))
01306         self.assertEqual(record.rounds[1].alignments[0].hsps[0].identities, (333, 369))
01307         self.assertEqual(record.rounds[1].alignments[0].hsps[0].positives, (351, 369))
01308         self.assertEqual(record.rounds[1].alignments[1].hsps[0].identities, (280, 367))
01309         self.assertEqual(record.rounds[1].alignments[1].hsps[0].positives, (316, 367))
01310         self.assertEqual(record.rounds[1].alignments[1].hsps[0].gaps, (2, 367))
01311         self.assertEqual(record.rounds[1].alignments[2].hsps[0].identities, (276, 369))
01312         self.assertEqual(record.rounds[1].alignments[2].hsps[0].positives, (316, 369))
01313         self.assertEqual(record.rounds[1].alignments[2].hsps[0].gaps, (2, 369))
01314         self.assertEqual(record.rounds[1].alignments[3].hsps[0].identities, (369, 369))
01315         self.assertEqual(record.rounds[1].alignments[3].hsps[0].positives, (369, 369))
01316         self.assertEqual(record.rounds[1].alignments[4].hsps[0].identities, (282, 369))
01317         self.assertEqual(record.rounds[1].alignments[4].hsps[0].positives, (320, 369))
01318         self.assertEqual(record.rounds[1].alignments[4].hsps[0].gaps, (2, 369))
01319         self.assertEqual(record.rounds[1].alignments[5].hsps[0].identities, (193, 368))
01320         self.assertEqual(record.rounds[1].alignments[5].hsps[0].positives, (268, 368))
01321         self.assertEqual(record.rounds[1].alignments[6].hsps[0].identities, (60, 314))
01322         self.assertEqual(record.rounds[1].alignments[6].hsps[0].positives, (114, 314))
01323         self.assertEqual(record.rounds[1].alignments[6].hsps[0].gaps, (12, 314))
01324         self.assertEqual(record.rounds[1].alignments[7].hsps[0].identities, (36, 154))
01325         self.assertEqual(record.rounds[1].alignments[7].hsps[0].positives, (66, 154))
01326         self.assertEqual(record.rounds[1].alignments[7].hsps[0].gaps, (5, 154))
01327         self.assertEqual(record.rounds[1].alignments[8].hsps[0].identities, (32, 121))
01328         self.assertEqual(record.rounds[1].alignments[8].hsps[0].positives, (55, 121))
01329         self.assertEqual(record.rounds[1].alignments[8].hsps[0].gaps, (4, 121))
01330         self.assertEqual(record.rounds[1].alignments[9].hsps[0].identities, (32, 121))
01331         self.assertEqual(record.rounds[1].alignments[9].hsps[0].positives, (55, 121))
01332         self.assertEqual(record.rounds[1].alignments[9].hsps[0].gaps, (4, 121))
01333         self.assertEqual(record.rounds[1].alignments[10].hsps[0].identities, (30, 121))
01334         self.assertEqual(record.rounds[1].alignments[10].hsps[0].positives, (54, 121))
01335         self.assertEqual(record.rounds[1].alignments[10].hsps[0].gaps, (4, 121))
01336         self.assertEqual(record.rounds[1].alignments[11].hsps[0].identities, (30, 120))
01337         self.assertEqual(record.rounds[1].alignments[11].hsps[0].positives, (53, 120))
01338         self.assertEqual(record.rounds[1].alignments[11].hsps[0].gaps, (4, 120))
01339         self.assertEqual(record.rounds[1].alignments[12].hsps[0].identities, (29, 125))
01340         self.assertEqual(record.rounds[1].alignments[12].hsps[0].positives, (57, 125))
01341         self.assertEqual(record.rounds[1].alignments[12].hsps[0].gaps, (6, 125))
01342         self.assertEqual(record.rounds[1].alignments[13].hsps[0].identities, (20, 68))
01343         self.assertEqual(record.rounds[1].alignments[13].hsps[0].positives, (26, 68))
01344         self.assertEqual(record.rounds[1].alignments[13].hsps[0].gaps, (7, 68))
01345         self.assertEqual(record.rounds[1].alignments[14].hsps[0].identities, (33, 171))
01346         self.assertEqual(record.rounds[1].alignments[14].hsps[0].positives, (67, 171))
01347         self.assertEqual(record.rounds[1].alignments[14].hsps[0].gaps, (10, 171))
01348         self.assertEqual(record.rounds[1].alignments[15].hsps[0].identities, (22, 88))
01349         self.assertEqual(record.rounds[1].alignments[15].hsps[0].positives, (38, 88))
01350         self.assertEqual(record.rounds[1].alignments[15].hsps[0].gaps, (8, 88))
01351         self.assertEqual(record.rounds[1].alignments[16].hsps[0].identities, (50, 196))
01352         self.assertEqual(record.rounds[1].alignments[16].hsps[0].positives, (77, 196))
01353         self.assertEqual(record.rounds[1].alignments[16].hsps[0].gaps, (17, 196))
01354         self.assertEqual(record.rounds[1].alignments[17].hsps[0].identities, (50, 196))
01355         self.assertEqual(record.rounds[1].alignments[17].hsps[0].positives, (77, 196))
01356         self.assertEqual(record.rounds[1].alignments[17].hsps[0].gaps, (17, 196))
01357         self.assertEqual(record.rounds[1].alignments[18].hsps[0].identities, (50, 196))
01358         self.assertEqual(record.rounds[1].alignments[18].hsps[0].positives, (76, 196))
01359         self.assertEqual(record.rounds[1].alignments[18].hsps[0].gaps, (17, 196))
01360         self.assertEqual(record.rounds[1].alignments[19].hsps[0].identities, (19, 69))
01361         self.assertEqual(record.rounds[1].alignments[19].hsps[0].positives, (28, 69))
01362         self.assertEqual(record.rounds[1].alignments[19].hsps[0].gaps, (3, 69))
01363         self.assertEqual(record.rounds[1].alignments[20].hsps[0].identities, (18, 72))
01364         self.assertEqual(record.rounds[1].alignments[20].hsps[0].positives, (31, 72))
01365         self.assertEqual(record.rounds[1].alignments[20].hsps[0].gaps, (2, 72))
01366         self.assertEqual(record.rounds[1].alignments[21].hsps[0].identities, (16, 85))
01367         self.assertEqual(record.rounds[1].alignments[21].hsps[0].positives, (35, 85))
01368         self.assertEqual(record.rounds[1].alignments[21].hsps[0].gaps, (2, 85))
01369         self.assertEqual(record.rounds[1].alignments[22].hsps[0].identities, (11, 57))
01370         self.assertEqual(record.rounds[1].alignments[22].hsps[0].positives, (27, 57))
01371         self.assertEqual(record.rounds[1].alignments[22].hsps[0].gaps, (3, 57))
01372         self.assertEqual(record.rounds[1].alignments[23].hsps[0].identities, (19, 79))
01373         self.assertEqual(record.rounds[1].alignments[23].hsps[0].positives, (31, 79))
01374         self.assertEqual(record.rounds[1].alignments[23].hsps[0].gaps, (2, 79))
01375         self.assertEqual(record.rounds[2].alignments[0].hsps[0].identities, (280, 367))
01376         self.assertEqual(record.rounds[2].alignments[0].hsps[0].positives, (316, 367))
01377         self.assertEqual(record.rounds[2].alignments[0].hsps[0].gaps, (2, 367))
01378         self.assertEqual(record.rounds[2].alignments[1].hsps[0].identities, (333, 369))
01379         self.assertEqual(record.rounds[2].alignments[1].hsps[0].positives, (351, 369))
01380         self.assertEqual(record.rounds[2].alignments[2].hsps[0].identities, (282, 369))
01381         self.assertEqual(record.rounds[2].alignments[2].hsps[0].positives, (320, 369))
01382         self.assertEqual(record.rounds[2].alignments[2].hsps[0].gaps, (2, 369))
01383         self.assertEqual(record.rounds[2].alignments[3].hsps[0].identities, (276, 369))
01384         self.assertEqual(record.rounds[2].alignments[3].hsps[0].positives, (316, 369))
01385         self.assertEqual(record.rounds[2].alignments[3].hsps[0].gaps, (2, 369))
01386         self.assertEqual(record.rounds[2].alignments[4].hsps[0].identities, (369, 369))
01387         self.assertEqual(record.rounds[2].alignments[4].hsps[0].positives, (369, 369))
01388         self.assertEqual(record.rounds[2].alignments[5].hsps[0].identities, (193, 368))
01389         self.assertEqual(record.rounds[2].alignments[5].hsps[0].positives, (268, 368))
01390         self.assertEqual(record.rounds[2].alignments[6].hsps[0].identities, (60, 314))
01391         self.assertEqual(record.rounds[2].alignments[6].hsps[0].positives, (114, 314))
01392         self.assertEqual(record.rounds[2].alignments[6].hsps[0].gaps, (12, 314))
01393         self.assertEqual(record.rounds[2].alignments[7].hsps[0].identities, (47, 266))
01394         self.assertEqual(record.rounds[2].alignments[7].hsps[0].positives, (90, 266))
01395         self.assertEqual(record.rounds[2].alignments[7].hsps[0].gaps, (20, 266))
01396         self.assertEqual(record.rounds[2].alignments[8].hsps[0].identities, (43, 216))
01397         self.assertEqual(record.rounds[2].alignments[8].hsps[0].positives, (78, 216))
01398         self.assertEqual(record.rounds[2].alignments[8].hsps[0].gaps, (13, 216))
01399         self.assertEqual(record.rounds[2].alignments[9].hsps[0].identities, (42, 182))
01400         self.assertEqual(record.rounds[2].alignments[9].hsps[0].positives, (74, 182))
01401         self.assertEqual(record.rounds[2].alignments[9].hsps[0].gaps, (8, 182))
01402         self.assertEqual(record.rounds[2].alignments[10].hsps[0].identities, (42, 215))
01403         self.assertEqual(record.rounds[2].alignments[10].hsps[0].positives, (76, 215))
01404         self.assertEqual(record.rounds[2].alignments[10].hsps[0].gaps, (11, 215))
01405         self.assertEqual(record.rounds[2].alignments[11].hsps[0].identities, (46, 266))
01406         self.assertEqual(record.rounds[2].alignments[11].hsps[0].positives, (88, 266))
01407         self.assertEqual(record.rounds[2].alignments[11].hsps[0].gaps, (20, 266))
01408         self.assertEqual(record.rounds[2].alignments[12].hsps[0].identities, (46, 222))
01409         self.assertEqual(record.rounds[2].alignments[12].hsps[0].positives, (82, 222))
01410         self.assertEqual(record.rounds[2].alignments[12].hsps[0].gaps, (15, 222))
01411         self.assertEqual(record.rounds[2].alignments[13].hsps[0].identities, (46, 222))
01412         self.assertEqual(record.rounds[2].alignments[13].hsps[0].positives, (82, 222))
01413         self.assertEqual(record.rounds[2].alignments[13].hsps[0].gaps, (15, 222))
01414         self.assertEqual(record.rounds[2].alignments[14].hsps[0].identities, (46, 222))
01415         self.assertEqual(record.rounds[2].alignments[14].hsps[0].positives, (81, 222))
01416         self.assertEqual(record.rounds[2].alignments[14].hsps[0].gaps, (15, 222))
01417         self.assertEqual(record.rounds[2].alignments[15].hsps[0].identities, (46, 221))
01418         self.assertEqual(record.rounds[2].alignments[15].hsps[0].positives, (73, 221))
01419         self.assertEqual(record.rounds[2].alignments[15].hsps[0].gaps, (24, 221))
01420         self.assertEqual(record.rounds[2].alignments[16].hsps[0].identities, (31, 155))
01421         self.assertEqual(record.rounds[2].alignments[16].hsps[0].positives, (58, 155))
01422         self.assertEqual(record.rounds[2].alignments[16].hsps[0].gaps, (4, 155))
01423         self.assertEqual(record.rounds[2].alignments[17].hsps[0].identities, (29, 193))
01424         self.assertEqual(record.rounds[2].alignments[17].hsps[0].positives, (67, 193))
01425         self.assertEqual(record.rounds[2].alignments[17].hsps[0].gaps, (12, 193))
01426         self.assertEqual(record.rounds[2].alignments[18].hsps[0].identities, (31, 155))
01427         self.assertEqual(record.rounds[2].alignments[18].hsps[0].positives, (57, 155))
01428         self.assertEqual(record.rounds[2].alignments[18].hsps[0].gaps, (4, 155))
01429         self.assertEqual(record.rounds[2].alignments[19].hsps[0].identities, (26, 105))
01430         self.assertEqual(record.rounds[2].alignments[19].hsps[0].positives, (37, 105))
01431         self.assertEqual(record.rounds[2].alignments[19].hsps[0].gaps, (3, 105))
01432         self.assertEqual(record.rounds[2].alignments[20].hsps[0].identities, (16, 55))
01433         self.assertEqual(record.rounds[2].alignments[20].hsps[0].positives, (22, 55))
01434         self.assertEqual(record.rounds[2].alignments[20].hsps[0].gaps, (3, 55))
01435         self.assertEqual(record.rounds[2].alignments[21].hsps[0].identities, (39, 188))
01436         self.assertEqual(record.rounds[2].alignments[21].hsps[0].positives, (62, 188))
01437         self.assertEqual(record.rounds[2].alignments[21].hsps[0].gaps, (23, 188))
01438         self.assertEqual(record.rounds[2].alignments[22].hsps[0].identities, (28, 146))
01439         self.assertEqual(record.rounds[2].alignments[22].hsps[0].positives, (53, 146))
01440         self.assertEqual(record.rounds[2].alignments[22].hsps[0].gaps, (8, 146))

Here is the caller graph for this function:

Definition at line 1441 of file test_NCBITextParser.py.

01441 
01442     def _check_bt007_hsps_details(self, record):
01443         self.assertEqual(record.rounds[0].alignments[0].hsps[0].query, "MKRKAKTIIAGIVALAVSQGAMADDIKVAIVGAMSGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGDLKGFEFGVFQWHADGSSTVAK")
01444         self.assertEqual(record.rounds[0].alignments[0].hsps[0].match, "MKRKAKTIIAGIVALAVSQGAMADDIKVAIVGAMSGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGDLKGFEFGVFQWHADGSSTVAK")
01445         self.assertEqual(record.rounds[0].alignments[0].hsps[0].sbjct, "MKRKAKTIIAGIVALAVSQGAMADDIKVAIVGAMSGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGDLKGFEFGVFQWHADGSSTVAK")
01446         self.assertEqual(record.rounds[0].alignments[0].hsps[0].query_start, 1)
01447         self.assertEqual(record.rounds[0].alignments[0].hsps[0].query_end, 369)
01448         self.assertEqual(record.rounds[0].alignments[0].hsps[0].sbjct_start, 1)
01449         self.assertEqual(record.rounds[0].alignments[0].hsps[0].sbjct_end, 369)
01450         self.assertEqual(record.rounds[0].alignments[1].hsps[0].query, "MKRKAKTIIAGIVALAVSQGAMADDIKVAIVGAMSGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGDLKGFEFGVFQWHADGSSTVAK")
01451         self.assertEqual(record.rounds[0].alignments[1].hsps[0].match, "MKR AKTIIAG++ALA+S  AMADDIKVA+VGAMSGP+AQWG MEFNGA QAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGI+YVIGHLCSSSTQPASDIYEDEGILMISPGAT PELTQRGYQ+IMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLK  NAN+VFFDGITAGEKDFSALIARL+KENIDFVYYGGYYPEMGQ++RQAR+ GLKTQFMGPEGVGNASLSNIAG AAEGMLVTMPKRYDQDPAN+ IV+ALKADKKDPSGPYVWITYAAVQSLATA+ R+ S  PL LVKDLKANGA+TVIGPL WDEKGDLKGF+FGVFQWHADGSST AK")
01452         self.assertEqual(record.rounds[0].alignments[1].hsps[0].sbjct, "MKRNAKTIIAGMIALAISHTAMADDIKVAVVGAMSGPIAQWGIMEFNGAEQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATAPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTAAK")
01453         self.assertEqual(record.rounds[0].alignments[1].hsps[0].query_start, 1)
01454         self.assertEqual(record.rounds[0].alignments[1].hsps[0].query_end, 369)
01455         self.assertEqual(record.rounds[0].alignments[1].hsps[0].sbjct_start, 1)
01456         self.assertEqual(record.rounds[0].alignments[1].hsps[0].sbjct_end, 369)
01457         self.assertEqual(record.rounds[0].alignments[2].hsps[0].query, "MKRKAKTIIAGIVALAVSQGAMADDIKVAIVGAMSGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGDLKGFEFGVFQWHADGSSTVAK")
01458         self.assertEqual(record.rounds[0].alignments[2].hsps[0].match, "M  K K ++AG++ALA S  A+A+DIKVA+VGAMSGPVAQ+GD EF GA QA+ DINAKGGIKG+KL   +YDDACDPKQAVAVANK+VNDGI+YVIGHLCSSSTQPASDIYEDEGILMI+P AT PELT RGYQ I+RT GLDS QGPTAAKYILE VKPQRIAI+HDKQQYGEGLAR+VQDGLK+GNAN+VFFDGITAGEKDFS L+ARL+KENIDFVYYGGY+PEMGQI+RQARA GLKTQFMGPEGV N SLSNIAG +AEG+LVT PK YDQ PANK IV+A+KA K+DPSG +VW TYAA+QSL   + +S    P ++ K LKAN  DTV+GPL WDEKGDLKGFEFGVF WHA+G++T AK")
01459         self.assertEqual(record.rounds[0].alignments[2].hsps[0].sbjct, "MNTKGKALLAGLIALAFSNMALAEDIKVAVVGAMSGPVAQYGDQEFTGAEQAVADINAKGGIKGNKLQIAKYDDACDPKQAVAVANKVVNDGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATAPELTARGYQLILRTTGLDSDQGPTAAKYILEKVKPQRIAIVHDKQQYGEGLARAVQDGLKKGNANVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNIAGESAEGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSDD--PAEIAKYLKANSVDTVMGPLTWDEKGDLKGFEFGVFDWHANGTATDAK")
01460         self.assertEqual(record.rounds[0].alignments[2].hsps[0].query_start, 1)
01461         self.assertEqual(record.rounds[0].alignments[2].hsps[0].query_end, 369)
01462         self.assertEqual(record.rounds[0].alignments[2].hsps[0].sbjct_start, 1)
01463         self.assertEqual(record.rounds[0].alignments[2].hsps[0].sbjct_end, 367)
01464         self.assertEqual(record.rounds[0].alignments[3].hsps[0].query, "KAKTIIAGIVALAVSQGAMADDIKVAIVGAMSGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGDLKGFEFGVFQWHADGSSTVAK")
01465         self.assertEqual(record.rounds[0].alignments[3].hsps[0].match, "K KT++AG +AL++S  A ADDIKVA+VGAMSGPVAQ+GD EF GA QAI DINAKGGIKGDKLV V+YDDACDPKQAVAVANK+VNDGI+YVIGHLCSSSTQPASDIYEDEGILMI+P AT PELT RGY+ ++RT GLDS QGPTAAKYILE VKPQRIAIIHDKQQYGEGLAR+VQDGLK+G  N+VFFDGITAGEKDFS L+ARL+KENIDFVYYGGY+PEMGQI+RQ+RA GLKTQFMGPEGV N SLSNIAG +AEG+LVT PK YDQ PANK IV+A+KA K+DPSG +VW TYAA+QSL   +  S    P ++ K LK    DTV+GPL WDEKGDLKGFEFGVF WHA+G++T AK")
01466         self.assertEqual(record.rounds[0].alignments[3].hsps[0].sbjct, "KGKTLLAGCIALSLSHMAFADDIKVAVVGAMSGPVAQYGDQEFTGAEQAIADINAKGGIKGDKLVAVKYDDACDPKQAVAVANKVVNDGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATAPELTARGYKLVLRTTGLDSDQGPTAAKYILEKVKPQRIAIIHDKQQYGEGLARAVQDGLKKGGVNVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQSRAAGLKTQFMGPEGVANVSLSNIAGESAEGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNHSDD--PAEIAKYLKGATVDTVMGPLSWDEKGDLKGFEFGVFDWHANGTATDAK")
01467         self.assertEqual(record.rounds[0].alignments[3].hsps[0].query_start, 4)
01468         self.assertEqual(record.rounds[0].alignments[3].hsps[0].query_end, 369)
01469         self.assertEqual(record.rounds[0].alignments[3].hsps[0].sbjct_start, 2)
01470         self.assertEqual(record.rounds[0].alignments[3].hsps[0].sbjct_end, 365)
01471         self.assertEqual(record.rounds[0].alignments[4].hsps[0].query, "MKRKAKTIIAGIVALAVSQGAMADDIKVAIVGAMSGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGDLKGFEFGVFQWHADGSSTVAK")
01472         self.assertEqual(record.rounds[0].alignments[4].hsps[0].match, "M  K K ++AG +AL++S  A A DIKVA+VGAMSGPVAQ+GD EF GA QAI DINAKGG+KGDKLV V+YDDACDPKQAVAVANK+VNDGI+YVIGHLCSSSTQPASDIYEDEGILMI+P AT PELT RGY  ++RT GLDS QGPTAAKYI+E VKP+RIAI+HDKQQYGEGLARSVQD LK+ NA++VFFDGITAGEKDFS L+ARL+KENIDFVYYGGY+PEMGQI+RQARA GLKTQFMGPEGV N SLSNIAG +AEG+LVT PK YDQ PANK IV+A+KA K+DPSG +VW TYAA+QSL   + +S    P ++ K LKAN  +TV+GPL WD KGDLKGFEFGVF WHA+G++T AK")
01473         self.assertEqual(record.rounds[0].alignments[4].hsps[0].sbjct, "MNMKGKALLAGCIALSLSNMAFAKDIKVAVVGAMSGPVAQYGDQEFTGAEQAIADINAKGGVKGDKLVMVKYDDACDPKQAVAVANKVVNDGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATAPELTARGYNLVLRTTGLDSDQGPTAAKYIVEKVKPKRIAIVHDKQQYGEGLARSVQDNLKKANADVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNIAGESAEGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSDD--PAEIAKYLKANSVETVMGPLSWDAKGDLKGFEFGVFDWHANGTATDAK")
01474         self.assertEqual(record.rounds[0].alignments[4].hsps[0].query_start, 1)
01475         self.assertEqual(record.rounds[0].alignments[4].hsps[0].query_end, 369)
01476         self.assertEqual(record.rounds[0].alignments[4].hsps[0].sbjct_start, 1)
01477         self.assertEqual(record.rounds[0].alignments[4].hsps[0].sbjct_end, 367)
01478         self.assertEqual(record.rounds[0].alignments[5].hsps[0].query, "KRKAKTIIAGIVALAVSQGAMADDIKVAIVGAMSGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGDLKGFEFGVFQWHADGSSTVAK")
01479         self.assertEqual(record.rounds[0].alignments[5].hsps[0].match, "+R ++   A  +A   S    AD IK+A+ G ++GPVAQ+GDM+  GA  AI+ IN  GG+ G +L GV YDDACDPKQAVAVANK+VNDG+++V+GH+CSSSTQPA+DIYEDEG+LMI+P AT PE+T RGY+ I RT GLD+ QGP A K+I E  K + IA++HDKQQYGEG+A  V+  ++     +  F+G+ AG+KDF+ALI++L+K  + FVY+GGY+PEMG ++RQA+  GL  +FMGPEGVGN+ ++ IAG A+EGML T+P+ ++QDP NKA+++A KA  +DPSG +V   Y+AV  +A  + ++    P  + + L+AN  +T  G L +DEKGDLK F+F V++WH D + T  K")
01480         self.assertEqual(record.rounds[0].alignments[5].hsps[0].sbjct, "QRLSRLFAAMAIAGFASYSMAADTIKIALAGPVTGPVAQYGDMQRAGALMAIEQINKAGGVNGAQLEGVIYDDACDPKQAVAVANKVVNDGVKFVVGHVCSSSTQPATDIYEDEGVLMITPSATAPEITSRGYKLIFRTIGLDNMQGPVAGKFIAERYKVKTIAVLHDKQQYGEGIATEVKKTVEDAGIKVAVFEGLNAGDKDFNALISKLKKAGVQFVYFGGYHPEMGLLLRQAKQAGLDARFMGPEGVGNSEITAIAGDASEGMLATLPRAFEQDPKNKALIDAFKAKNQDPSGIFVLPAYSAVTVIAKGIEKAGEADPEKVAEALRANTFETPTGNLGFDEKGDLKNFDFTVYEWHKDATRTEVK")
01481         self.assertEqual(record.rounds[0].alignments[5].hsps[0].query_start, 2)
01482         self.assertEqual(record.rounds[0].alignments[5].hsps[0].query_end, 369)
01483         self.assertEqual(record.rounds[0].alignments[5].hsps[0].sbjct_start, 6)
01484         self.assertEqual(record.rounds[0].alignments[5].hsps[0].sbjct_end, 373)
01485         self.assertEqual(record.rounds[0].alignments[6].hsps[0].query, "IVGAMSGPVAQWGDMEFN---GARQAIKDINAKGGIKGDKLVGVEYDDACDP-KQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQY---IMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIV--FFDGITAGEKDFSALIARLQKENIDFVY---YGGYYPEMGQIVRQARANGLKTQFMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQD-PANKAIVEALKADKKDPSGPYVWITYAAVQS--LATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGD")
01486         self.assertEqual(record.rounds[0].alignments[6].hsps[0].match, "++G +        D+E +   GA  A++ +N +GG+ G  +  +  D   DP +  +   + I N G+++++G   S + +    + E    L+  P          G++Y   I+      +      A Y++     +R+  I     Y       ++   +Q    ++   +  +   + D    + R+ +   D V+    G    E+ + + +   +G +   +       A ++ +    AEG +V  P     D PA++A V+A      + +    W   A  Q+  L  A   + + R  D+ + L     D   GP++ + + +")
01487         self.assertEqual(record.rounds[0].alignments[6].hsps[0].sbjct, "LIGLLFSETGVTADIERSHAYGALLAVEQLNREGGVGGRPIETLSQDPGGDPDRYRLCAEDFIRNRGVRFLVGCYMSHTRKAVMPVVERADALLCYP------TPYEGFEYSPNIVYGGPAPNQNSAPLAAYLIRHY-GERVVFIGSDYIYPRESNHVMRHLYRQHGGTVLEEIYIPLYPSDDDLQRAVERIYQARADVVFSTVVGTGTAELYRAIARRYGDGRRPP-IASLTTSEAEVAKMESDVAEGQVVVAPYFSSIDTPASRAFVQACHGFFPENATITAWAEAAYWQTLLLGRAAQAAGNWRVEDVQRHLYDIDIDAPQGPVRVERQNN")
01488         self.assertEqual(record.rounds[0].alignments[6].hsps[0].query_start, 30)
01489         self.assertEqual(record.rounds[0].alignments[6].hsps[0].query_end, 348)
01490         self.assertEqual(record.rounds[0].alignments[6].hsps[0].sbjct_start, 9)
01491         self.assertEqual(record.rounds[0].alignments[6].hsps[0].sbjct_end, 334)
01492         self.assertEqual(record.rounds[0].alignments[7].hsps[0].query, "GPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATA")
01493         self.assertEqual(record.rounds[0].alignments[7].hsps[0].match, "G +G  + ++ + AG     +L  + K  ++DP N  +V  +KA KK+     +W  Y   +  A A")
01494         self.assertEqual(record.rounds[0].alignments[7].hsps[0].sbjct, "GKQGEAHLAMRHYAGTVRYNVLNWLEK--NKDPLNDTVVSVMKASKKNDLLVEIWQDYTTQEEAAAA")
01495         self.assertEqual(record.rounds[0].alignments[7].hsps[0].query_start, 247)
01496         self.assertEqual(record.rounds[0].alignments[7].hsps[0].query_end, 313)
01497         self.assertEqual(record.rounds[0].alignments[7].hsps[0].sbjct_start, 570)
01498         self.assertEqual(record.rounds[0].alignments[7].hsps[0].sbjct_end, 634)
01499         self.assertEqual(record.rounds[0].alignments[8].hsps[0].query, "ASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKP------QRIAIIHDKQQYGEGLARSVQDGLKQGNA")
01500         self.assertEqual(record.rounds[0].alignments[8].hsps[0].match, "A  +Y D  +L++     N  L   G Q +M+       +G T    +L T +P      Q+I I+H+ QQ   GLAR V   L+Q +A")
01501         self.assertEqual(record.rounds[0].alignments[8].hsps[0].sbjct, "ARAMYGDPCLLILDE--PNASLDSEGDQALMQAIVALQKRGATV---VLITHRPALTTLAQKILILHEGQQQRMGLARDVLTELQQRSA")
01502         self.assertEqual(record.rounds[0].alignments[8].hsps[0].query_start, 108)
01503         self.assertEqual(record.rounds[0].alignments[8].hsps[0].query_end, 190)
01504         self.assertEqual(record.rounds[0].alignments[8].hsps[0].sbjct_start, 478)
01505         self.assertEqual(record.rounds[0].alignments[8].hsps[0].sbjct_end, 561)
01506         self.assertEqual(record.rounds[0].alignments[9].hsps[0].query, "VIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRG-YQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSA----LIARLQKE")
01507         self.assertEqual(record.rounds[0].alignments[9].hsps[0].match, "V+G   SS +   +++     I  +SP +TN +L+ +  ++Y  RT   D  Q   A   I    K   +++++   +YGE  A + +   ++    I   + I   ++ F+     L+ +LQ E")
01508         self.assertEqual(record.rounds[0].alignments[9].hsps[0].sbjct, "VVGGSYSSVSVQLANLLRLFRIAQVSPASTNADLSDKNRFEYFARTVPSDDYQA-MAMVEIAVKFKWSYVSLVYSADEYGELGADAFKKEARKKGICIALEERIQNKKESFTESINNLVQKLQPE")
01509         self.assertEqual(record.rounds[0].alignments[9].hsps[0].query_start, 96)
01510         self.assertEqual(record.rounds[0].alignments[9].hsps[0].query_end, 215)
01511         self.assertEqual(record.rounds[0].alignments[9].hsps[0].sbjct_start, 196)
01512         self.assertEqual(record.rounds[0].alignments[9].hsps[0].sbjct_end, 319)
01513         self.assertEqual(record.rounds[0].alignments[10].hsps[0].query, "KDFSALIARLQKENIDFVYYGGYYPEMGQIVRQARANGLK-TQFMGPEGVGN-ASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKK")
01514         self.assertEqual(record.rounds[0].alignments[10].hsps[0].match, "+ F A+ A +  E++  +  GG+  EM  + R +  +G+  ++F+ P+ +      +   GG    +L T    Y    A   +VEA+  DKK")
01515         self.assertEqual(record.rounds[0].alignments[10].hsps[0].sbjct, "RTFIAMEAGVSVEDVQAMLMGGHGDEMVPLPRFSTISGIPVSEFIAPDRLAQIVERTRKGGGEIVNLLKTGSAYYAPAAATAQMVEAVLKDKK")
01516         self.assertEqual(record.rounds[0].alignments[10].hsps[0].query_start, 203)
01517         self.assertEqual(record.rounds[0].alignments[10].hsps[0].query_end, 293)
01518         self.assertEqual(record.rounds[0].alignments[10].hsps[0].sbjct_start, 153)
01519         self.assertEqual(record.rounds[0].alignments[10].hsps[0].sbjct_end, 245)
01520         self.assertEqual(record.rounds[0].alignments[11].hsps[0].query, "QQYGEGLARS-----VQDGLKQGNANIVFFDGITAGEKDFSALIARL-QKENIDFVYYG---GYY")
01521         self.assertEqual(record.rounds[0].alignments[11].hsps[0].match, "Q YG GL  S     +   LK GNA +     IT G  +F+ L   L +K N  F+ YG   G+Y")
01522         self.assertEqual(record.rounds[0].alignments[11].hsps[0].sbjct, "QSYGHGLVISDNFVSISKPLKVGNAQLGTDGNITGGSGNFANLNTTLNRKVNSGFITYGATSGWY")
01523         self.assertEqual(record.rounds[0].alignments[11].hsps[0].query_start, 171)
01524         self.assertEqual(record.rounds[0].alignments[11].hsps[0].query_end, 226)
01525         self.assertEqual(record.rounds[0].alignments[11].hsps[0].sbjct_start, 716)
01526         self.assertEqual(record.rounds[0].alignments[11].hsps[0].sbjct_end, 780)
01527         self.assertEqual(record.rounds[0].alignments[12].hsps[0].query, "AIVEALKADKKDPSGPYVWITYA-AVQSLATAMTRSASHRPLDLVKDLKANGADT")
01528         self.assertEqual(record.rounds[0].alignments[12].hsps[0].match, "AI  A +AD+ D    Y +  +A A++S+  A+  ++   P+D + DLKA   +T")
01529         self.assertEqual(record.rounds[0].alignments[12].hsps[0].sbjct, "AIQVAKEADRIDGIEQYAFRAFADALESIPMALAENSGLAPIDALSDLKAKQIET")
01530         self.assertEqual(record.rounds[0].alignments[12].hsps[0].query_start, 283)
01531         self.assertEqual(record.rounds[0].alignments[12].hsps[0].query_end, 336)
01532         self.assertEqual(record.rounds[0].alignments[12].hsps[0].sbjct_start, 429)
01533         self.assertEqual(record.rounds[0].alignments[12].hsps[0].sbjct_end, 483)
01534         self.assertEqual(record.rounds[0].alignments[13].hsps[0].query, "KQAVAVANKIVN-DGIQYVIGHLCSSSTQPASDIYEDEGILMISPGA--TNPE-------LTQRGYQYIMRTAGLDSSQGPTAAKYILET")
01535         self.assertEqual(record.rounds[0].alignments[13].hsps[0].match, "K  ++ A ++V  +G+ Y +GH  +S         +DEG ++  PG   TN E       +  + Y+  + +AG        A K+I ET")
01536         self.assertEqual(record.rounds[0].alignments[13].hsps[0].sbjct, "KDVLSNAEEVVEANGLFYAVGHDPASGLVKGQVELDDEGYIITKPGTSFTNVEGVFACGDVQDKRYRQAITSAGSGCVAALEAEKFIAET")
01537         self.assertEqual(record.rounds[0].alignments[13].hsps[0].query_start, 79)
01538         self.assertEqual(record.rounds[0].alignments[13].hsps[0].query_end, 158)
01539         self.assertEqual(record.rounds[0].alignments[13].hsps[0].sbjct_start, 235)
01540         self.assertEqual(record.rounds[0].alignments[13].hsps[0].sbjct_end, 324)
01541         self.assertEqual(record.rounds[1].alignments[0].hsps[0].query, "MKRKAKTIIAGIVALAVSQGAMADDIKVAIVGAMSGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGDLKGFEFGVFQWHADGSSTVAK")
01542         self.assertEqual(record.rounds[1].alignments[0].hsps[0].match, "MKR AKTIIAG++ALA+S  AMADDIKVA+VGAMSGP+AQWG MEFNGA QAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGI+YVIGHLCSSSTQPASDIYEDEGILMISPGAT PELTQRGYQ+IMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLK  NAN+VFFDGITAGEKDFSALIARL+KENIDFVYYGGYYPEMGQ++RQAR+ GLKTQFMGPEGVGNASLSNIAG AAEGMLVTMPKRYDQDPAN+ IV+ALKADKKDPSGPYVWITYAAVQSLATA+ R+ S  PL LVKDLKANGA+TVIGPL WDEKGDLKGF+FGVFQWHADGSST AK")
01543         self.assertEqual(record.rounds[1].alignments[0].hsps[0].sbjct, "MKRNAKTIIAGMIALAISHTAMADDIKVAVVGAMSGPIAQWGIMEFNGAEQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATAPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTAAK")
01544         self.assertEqual(record.rounds[1].alignments[0].hsps[0].query_start, 1)
01545         self.assertEqual(record.rounds[1].alignments[0].hsps[0].query_end, 369)
01546         self.assertEqual(record.rounds[1].alignments[0].hsps[0].sbjct_start, 1)
01547         self.assertEqual(record.rounds[1].alignments[0].hsps[0].sbjct_end, 369)
01548         self.assertEqual(record.rounds[1].alignments[1].hsps[0].query, "RKAKTIIAGIVALAVSQGAMADDIKVAIVGAMSGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGDLKGFEFGVFQWHADGSSTVAK")
01549         self.assertEqual(record.rounds[1].alignments[1].hsps[0].match, " K KT++AG +AL++S  A ADDIKVA+VGAMSGPVAQ+GD EF GA QAI DINAKGGIKGDKLV V+YDDACDPKQAVAVANK+VNDGI+YVIGHLCSSSTQPASDIYEDEGILMI+P AT PELT RGY+ ++RT GLDS QGPTAAKYILE VKPQRIAIIHDKQQYGEGLAR+VQDGLK+G  N+VFFDGITAGEKDFS L+ARL+KENIDFVYYGGY+PEMGQI+RQ+RA GLKTQFMGPEGV N SLSNIAG +AEG+LVT PK YDQ PANK IV+A+KA K+DPSG +VW TYAA+QSL   +  S    P ++ K LK    DTV+GPL WDEKGDLKGFEFGVF WHA+G++T AK")
01550         self.assertEqual(record.rounds[1].alignments[1].hsps[0].sbjct, "MKGKTLLAGCIALSLSHMAFADDIKVAVVGAMSGPVAQYGDQEFTGAEQAIADINAKGGIKGDKLVAVKYDDACDPKQAVAVANKVVNDGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATAPELTARGYKLVLRTTGLDSDQGPTAAKYILEKVKPQRIAIIHDKQQYGEGLARAVQDGLKKGGVNVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQSRAAGLKTQFMGPEGVANVSLSNIAGESAEGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNHSD--DPAEIAKYLKGATVDTVMGPLSWDEKGDLKGFEFGVFDWHANGTATDAK")
01551         self.assertEqual(record.rounds[1].alignments[1].hsps[0].query_start, 3)
01552         self.assertEqual(record.rounds[1].alignments[1].hsps[0].query_end, 369)
01553         self.assertEqual(record.rounds[1].alignments[1].hsps[0].sbjct_start, 1)
01554         self.assertEqual(record.rounds[1].alignments[1].hsps[0].sbjct_end, 365)
01555         self.assertEqual(record.rounds[1].alignments[2].hsps[0].query, "MKRKAKTIIAGIVALAVSQGAMADDIKVAIVGAMSGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGDLKGFEFGVFQWHADGSSTVAK")
01556         self.assertEqual(record.rounds[1].alignments[2].hsps[0].match, "M  K K ++AG +AL++S  A A DIKVA+VGAMSGPVAQ+GD EF GA QAI DINAKGG+KGDKLV V+YDDACDPKQAVAVANK+VNDGI+YVIGHLCSSSTQPASDIYEDEGILMI+P AT PELT RGY  ++RT GLDS QGPTAAKYI+E VKP+RIAI+HDKQQYGEGLARSVQD LK+ NA++VFFDGITAGEKDFS L+ARL+KENIDFVYYGGY+PEMGQI+RQARA GLKTQFMGPEGV N SLSNIAG +AEG+LVT PK YDQ PANK IV+A+KA K+DPSG +VW TYAA+QSL   + +S    P ++ K LKAN  +TV+GPL WD KGDLKGFEFGVF WHA+G++T AK")
01557         self.assertEqual(record.rounds[1].alignments[2].hsps[0].sbjct, "MNMKGKALLAGCIALSLSNMAFAKDIKVAVVGAMSGPVAQYGDQEFTGAEQAIADINAKGGVKGDKLVMVKYDDACDPKQAVAVANKVVNDGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATAPELTARGYNLVLRTTGLDSDQGPTAAKYIVEKVKPKRIAIVHDKQQYGEGLARSVQDNLKKANADVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNIAGESAEGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSD--DPAEIAKYLKANSVETVMGPLSWDAKGDLKGFEFGVFDWHANGTATDAK")
01558         self.assertEqual(record.rounds[1].alignments[2].hsps[0].query_start, 1)
01559         self.assertEqual(record.rounds[1].alignments[2].hsps[0].query_end, 369)
01560         self.assertEqual(record.rounds[1].alignments[2].hsps[0].sbjct_start, 1)
01561         self.assertEqual(record.rounds[1].alignments[2].hsps[0].sbjct_end, 367)
01562         self.assertEqual(record.rounds[1].alignments[3].hsps[0].query, "MKRKAKTIIAGIVALAVSQGAMADDIKVAIVGAMSGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGDLKGFEFGVFQWHADGSSTVAK")
01563         self.assertEqual(record.rounds[1].alignments[3].hsps[0].match, "MKRKAKTIIAGIVALAVSQGAMADDIKVAIVGAMSGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGDLKGFEFGVFQWHADGSSTVAK")
01564         self.assertEqual(record.rounds[1].alignments[3].hsps[0].sbjct, "MKRKAKTIIAGIVALAVSQGAMADDIKVAIVGAMSGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGDLKGFEFGVFQWHADGSSTVAK")
01565         self.assertEqual(record.rounds[1].alignments[3].hsps[0].query_start, 1)
01566         self.assertEqual(record.rounds[1].alignments[3].hsps[0].query_end, 369)
01567         self.assertEqual(record.rounds[1].alignments[3].hsps[0].sbjct_start, 1)
01568         self.assertEqual(record.rounds[1].alignments[3].hsps[0].sbjct_end, 369)
01569         self.assertEqual(record.rounds[1].alignments[4].hsps[0].query, "MKRKAKTIIAGIVALAVSQGAMADDIKVAIVGAMSGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGDLKGFEFGVFQWHADGSSTVAK")
01570         self.assertEqual(record.rounds[1].alignments[4].hsps[0].match, "M  K K ++AG++ALA S  A+A+DIKVA+VGAMSGPVAQ+GD EF GA QA+ DINAKGGIKG+KL   +YDDACDPKQAVAVANK+VNDGI+YVIGHLCSSSTQPASDIYEDEGILMI+P AT PELT RGYQ I+RT GLDS QGPTAAKYILE VKPQRIAI+HDKQQYGEGLAR+VQDGLK+GNAN+VFFDGITAGEKDFS L+ARL+KENIDFVYYGGY+PEMGQI+RQARA GLKTQFMGPEGV N SLSNIAG +AEG+LVT PK YDQ PANK IV+A+KA K+DPSG +VW TYAA+QSL   + +S    P ++ K LKAN  DTV+GPL WDEKGDLKGFEFGVF WHA+G++T AK")
01571         self.assertEqual(record.rounds[1].alignments[4].hsps[0].sbjct, "MNTKGKALLAGLIALAFSNMALAEDIKVAVVGAMSGPVAQYGDQEFTGAEQAVADINAKGGIKGNKLQIAKYDDACDPKQAVAVANKVVNDGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATAPELTARGYQLILRTTGLDSDQGPTAAKYILEKVKPQRIAIVHDKQQYGEGLARAVQDGLKKGNANVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNIAGESAEGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSD--DPAEIAKYLKANSVDTVMGPLTWDEKGDLKGFEFGVFDWHANGTATDAK")
01572         self.assertEqual(record.rounds[1].alignments[4].hsps[0].query_start, 1)
01573         self.assertEqual(record.rounds[1].alignments[4].hsps[0].query_end, 369)
01574         self.assertEqual(record.rounds[1].alignments[4].hsps[0].sbjct_start, 1)
01575         self.assertEqual(record.rounds[1].alignments[4].hsps[0].sbjct_end, 367)
01576         self.assertEqual(record.rounds[1].alignments[5].hsps[0].query, "KRKAKTIIAGIVALAVSQGAMADDIKVAIVGAMSGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGDLKGFEFGVFQWHADGSSTVAK")
01577         self.assertEqual(record.rounds[1].alignments[5].hsps[0].match, "+R ++   A  +A   S    AD IK+A+ G ++GPVAQ+GDM+  GA  AI+ IN  GG+ G +L GV YDDACDPKQAVAVANK+VNDG+++V+GH+CSSSTQPA+DIYEDEG+LMI+P AT PE+T RGY+ I RT GLD+ QGP A K+I E  K + IA++HDKQQYGEG+A  V+  ++     +  F+G+ AG+KDF+ALI++L+K  + FVY+GGY+PEMG ++RQA+  GL  +FMGPEGVGN+ ++ IAG A+EGML T+P+ ++QDP NKA+++A KA  +DPSG +V   Y+AV  +A  + ++    P  + + L+AN  +T  G L +DEKGDLK F+F V++WH D + T  K")
01578         self.assertEqual(record.rounds[1].alignments[5].hsps[0].sbjct, "QRLSRLFAAMAIAGFASYSMAADTIKIALAGPVTGPVAQYGDMQRAGALMAIEQINKAGGVNGAQLEGVIYDDACDPKQAVAVANKVVNDGVKFVVGHVCSSSTQPATDIYEDEGVLMITPSATAPEITSRGYKLIFRTIGLDNMQGPVAGKFIAERYKVKTIAVLHDKQQYGEGIATEVKKTVEDAGIKVAVFEGLNAGDKDFNALISKLKKAGVQFVYFGGYHPEMGLLLRQAKQAGLDARFMGPEGVGNSEITAIAGDASEGMLATLPRAFEQDPKNKALIDAFKAKNQDPSGIFVLPAYSAVTVIAKGIEKAGEADPEKVAEALRANTFETPTGNLGFDEKGDLKNFDFTVYEWHKDATRTEVK")
01579         self.assertEqual(record.rounds[1].alignments[5].hsps[0].query_start, 2)
01580         self.assertEqual(record.rounds[1].alignments[5].hsps[0].query_end, 369)
01581         self.assertEqual(record.rounds[1].alignments[5].hsps[0].sbjct_start, 6)
01582         self.assertEqual(record.rounds[1].alignments[5].hsps[0].sbjct_end, 373)
01583         self.assertEqual(record.rounds[1].alignments[6].hsps[0].query, "SGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIV-NDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIV--FFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQIVRQ-ARANGLKTQ-FMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQD-PANKAIVEALKADKKDPSGPYVW--ITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGP")
01584         self.assertEqual(record.rounds[1].alignments[6].hsps[0].match, "+G  A        GA  A++ +N +GG+ G  +  +  D   DP +    A   + N G+++++G   S + +    + E    L+  P  T  E  +     +      + +  P AA  I      +R+  I     Y       ++   +Q    ++   +  +   + D    + R+ +   D V+         ++ R  AR  G   +  +       A ++ +    AEG +V  P     D PA++A V+A      + +    W    Y     L  A   + + R  D+ + L     D   GP")
01585         self.assertEqual(record.rounds[1].alignments[6].hsps[0].sbjct, "TGVTADIERSHAYGALLAVEQLNREGGVGGRPIETLSQDPGGDPDRYRLCAEDFIRNRGVRFLVGCYMSHTRKAVMPVVERADALLCYP--TPYEGFEYSPNIVYGGPAPNQNSAPLAAYLI--RHYGERVVFIGSDYIYPRESNHVMRHLYRQHGGTVLEEIYIPLYPSDDDLQRAVERIYQARADVVFSTVVGTGTAELYRAIARRYGDGRRPPIASLTTSEAEVAKMESDVAEGQVVVAPYFSSIDTPASRAFVQACHGFFPENATITAWAEAAYWQTLLLGRAAQAAGNWRVEDVQRHLYDIDIDAPQGP")
01586         self.assertEqual(record.rounds[1].alignments[6].hsps[0].query_start, 35)
01587         self.assertEqual(record.rounds[1].alignments[6].hsps[0].query_end, 340)
01588         self.assertEqual(record.rounds[1].alignments[6].hsps[0].sbjct_start, 17)
01589         self.assertEqual(record.rounds[1].alignments[6].hsps[0].sbjct_end, 326)
01590         self.assertEqual(record.rounds[1].alignments[7].hsps[0].query, "VIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRG-YQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGI--TAGEKDFSALIARL-QKENIDFVYYGGYYPEMGQIVRQARANGLKTQF")
01591         self.assertEqual(record.rounds[1].alignments[7].hsps[0].match, "VIG   SS +   +++     I  +SP +T   L+ +  +    RT   D+ Q   A   IL+      ++ IH +  YGE    ++     + N  I   + +   A +K F ++I++L +K N   V       +  +I++ A+   L   F")
01592         self.assertEqual(record.rounds[1].alignments[7].hsps[0].sbjct, "VIGGSYSSVSLQVANLLRLFHIPQVSPASTAKTLSDKTRFDLFARTVPPDTFQS-VALVDILKNFNWSYVSTIHSEGSYGEYGIEALHKEATERNVCIAVAEKVPSAADDKVFDSIISKLQKKPNARGVVLFTRAEDARRILQAAKRANLSQPF")
01593         self.assertEqual(record.rounds[1].alignments[7].hsps[0].query_start, 96)
01594         self.assertEqual(record.rounds[1].alignments[7].hsps[0].query_end, 245)
01595         self.assertEqual(record.rounds[1].alignments[7].hsps[0].sbjct_start, 152)
01596         self.assertEqual(record.rounds[1].alignments[7].hsps[0].sbjct_end, 304)
01597         self.assertEqual(record.rounds[1].alignments[8].hsps[0].query, "VIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRG-YQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGI--TAGEKDFSALIARLQ")
01598         self.assertEqual(record.rounds[1].alignments[8].hsps[0].match, "VIG   SS      ++ +   I  I+  AT+ +L+ +  Y+Y +R    D+ Q   A   I++      ++ +H +  YGE    + ++   Q    I   D I   AGEK F  L+ +L+")
01599         self.assertEqual(record.rounds[1].alignments[8].hsps[0].sbjct, "VIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQA-RAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLR")
01600         self.assertEqual(record.rounds[1].alignments[8].hsps[0].query_start, 96)
01601         self.assertEqual(record.rounds[1].alignments[8].hsps[0].query_end, 213)
01602         self.assertEqual(record.rounds[1].alignments[8].hsps[0].sbjct_start, 159)
01603         self.assertEqual(record.rounds[1].alignments[8].hsps[0].sbjct_end, 278)
01604         self.assertEqual(record.rounds[1].alignments[9].hsps[0].query, "VIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRG-YQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGI--TAGEKDFSALIARLQ")
01605         self.assertEqual(record.rounds[1].alignments[9].hsps[0].match, "VIG   SS      ++ +   I  I+  AT+ +L+ +  Y+Y +R    D+ Q   A   I++      ++ +H +  YGE    + ++   Q    I   D I   AGEK F  L+ +L+")
01606         self.assertEqual(record.rounds[1].alignments[9].hsps[0].sbjct, "VIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQA-RAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLR")
01607         self.assertEqual(record.rounds[1].alignments[9].hsps[0].query_start, 96)
01608         self.assertEqual(record.rounds[1].alignments[9].hsps[0].query_end, 213)
01609         self.assertEqual(record.rounds[1].alignments[9].hsps[0].sbjct_start, 159)
01610         self.assertEqual(record.rounds[1].alignments[9].hsps[0].sbjct_end, 278)
01611         self.assertEqual(record.rounds[1].alignments[10].hsps[0].query, "VIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRG-YQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGI--TAGEKDFSALIARLQ")
01612         self.assertEqual(record.rounds[1].alignments[10].hsps[0].match, "VIG   SS      ++ +   I  I+  AT+ +L+ +  ++Y MR    D+ Q   A   I++      ++ +H +  YGE    + +D   +    I     I   AGE+ F  L+ +L+")
01613         self.assertEqual(record.rounds[1].alignments[10].hsps[0].sbjct, "VIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQA-RAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGICIAHSYKIYSNAGEQSFDKLLKKLR")
01614         self.assertEqual(record.rounds[1].alignments[10].hsps[0].query_start, 96)
01615         self.assertEqual(record.rounds[1].alignments[10].hsps[0].query_end, 213)
01616         self.assertEqual(record.rounds[1].alignments[10].hsps[0].sbjct_start, 145)
01617         self.assertEqual(record.rounds[1].alignments[10].hsps[0].sbjct_end, 264)
01618         self.assertEqual(record.rounds[1].alignments[11].hsps[0].query, "VIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRG-YQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGI--TAGEKDFSALIARL")
01619         self.assertEqual(record.rounds[1].alignments[11].hsps[0].match, "VIG   SS      ++ +   I  I+  AT+ +L+ +  ++Y MR    D+ Q   A   I++      ++ +H +  YGE    + +D   +    I     I   AGE+ F  L+ +L")
01620         self.assertEqual(record.rounds[1].alignments[11].hsps[0].sbjct, "VIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQA-RAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGICIAHSYKIYSNAGEQSFDKLLKKL")
01621         self.assertEqual(record.rounds[1].alignments[11].hsps[0].query_start, 96)
01622         self.assertEqual(record.rounds[1].alignments[11].hsps[0].query_end, 212)
01623         self.assertEqual(record.rounds[1].alignments[11].hsps[0].sbjct_start, 146)
01624         self.assertEqual(record.rounds[1].alignments[11].hsps[0].sbjct_end, 264)
01625         self.assertEqual(record.rounds[1].alignments[12].hsps[0].query, "VIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRG-YQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDF----SALIARLQKE")
01626         self.assertEqual(record.rounds[1].alignments[12].hsps[0].match, "V+G   SS +   +++     I  +SP +TN +L+ +  ++Y  RT   D  Q   A   I    K   +++++   +YGE  A + +   ++    I   + I   ++ F    + L+ +LQ E")
01627         self.assertEqual(record.rounds[1].alignments[12].hsps[0].sbjct, "VVGGSYSSVSVQLANLLRLFRIAQVSPASTNADLSDKNRFEYFARTVPSDDYQA-MAMVEIAVKFKWSYVSLVYSADEYGELGADAFKKEARKKGICIALEERIQNKKESFTESINNLVQKLQPE")
01628         self.assertEqual(record.rounds[1].alignments[12].hsps[0].query_start, 96)
01629         self.assertEqual(record.rounds[1].alignments[12].hsps[0].query_end, 215)
01630         self.assertEqual(record.rounds[1].alignments[12].hsps[0].sbjct_start, 196)
01631         self.assertEqual(record.rounds[1].alignments[12].hsps[0].sbjct_end, 319)
01632         self.assertEqual(record.rounds[1].alignments[13].hsps[0].query, "AGIVALAVSQGAMADDIKVAI---VGAMSGPVAQWGDMEFNGARQAIKDINAKGG----IKGDKLVGV")
01633         self.assertEqual(record.rounds[1].alignments[13].hsps[0].match, "A   A   S   +   I  AI    G+ +GPV Q+ +   NG+  A       GG      G  L GV")
01634         self.assertEqual(record.rounds[1].alignments[13].hsps[0].sbjct, "AAAAAGEASHVVVGGSIDAAIDTAKGSRAGPVEQYVNQAANGSLIAAASALVAGGGTEDAAGAILAGV")
01635         self.assertEqual(record.rounds[1].alignments[13].hsps[0].query_start, 10)
01636         self.assertEqual(record.rounds[1].alignments[13].hsps[0].query_end, 70)
01637         self.assertEqual(record.rounds[1].alignments[13].hsps[0].sbjct_start, 315)
01638         self.assertEqual(record.rounds[1].alignments[13].hsps[0].sbjct_end, 382)
01639         self.assertEqual(record.rounds[1].alignments[14].hsps[0].query, "AIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGL---DSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSALIARLQKENIDF")
01640         self.assertEqual(record.rounds[1].alignments[14].hsps[0].match, "AI+     G  K  K+V V  D+A   K+ V V    +    ++  G +C++S    S+IY+   IL  +P  +  ++ +   +   +  G+   DS   P     +   +    I  + D++   +   R ++         +     +  GE D    +  ++  N+ F")
01641         self.assertEqual(record.rounds[1].alignments[14].hsps[0].sbjct, "AIELAKKTG--KDPKVVQVILDEA---KEIVKVGKNFIITETKH--GFVCANSGVDESNIYKGIKILPKNPDESAEKIRKEIEKLTGKRVGVIISDSVGRPFRKGAVGIAIGVSGILALWDRKGEKDLFGRELKTTEVAIADELASMANVVMGEADEGIPVVIIRGANVPF")
01642         self.assertEqual(record.rounds[1].alignments[14].hsps[0].query_start, 52)
01643         self.assertEqual(record.rounds[1].alignments[14].hsps[0].query_end, 219)
01644         self.assertEqual(record.rounds[1].alignments[14].hsps[0].sbjct_start, 67)
01645         self.assertEqual(record.rounds[1].alignments[14].hsps[0].sbjct_end, 230)
01646         self.assertEqual(record.rounds[1].alignments[15].hsps[0].query, "GPTAAKYILETVKP---QRIAIIHDK--QQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSAL--IARLQKENID-FVYYGGYYP")
01647         self.assertEqual(record.rounds[1].alignments[15].hsps[0].match, "GP A   + E  K    ++  ++ DK  +   +G        L++   ++V FDG+    KD +    +   +KE+ D  V  GG  P")
01648         self.assertEqual(record.rounds[1].alignments[15].hsps[0].sbjct, "GPNAISVVGERCKLLGGKKALLVTDKGLRAIKDGAVDKTLTHLREAGIDVVVFDGVEPNPKDTNVRDGLEVFRKEHCDIIVTVGGGSP")
01649         self.assertEqual(record.rounds[1].alignments[15].hsps[0].query_start, 148)
01650         self.assertEqual(record.rounds[1].alignments[15].hsps[0].query_end, 227)
01651         self.assertEqual(record.rounds[1].alignments[15].hsps[0].sbjct_start, 17)
01652         self.assertEqual(record.rounds[1].alignments[15].hsps[0].sbjct_end, 104)
01653         self.assertEqual(record.rounds[1].alignments[16].hsps[0].query, "DGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQR-GYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGE-GLARSVQDGLKQGNANIVFFDGITAGEK--DFSALIAR-LQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFM--GPEGVGNASLSNIA-----GGAAEGMLVTMPKR")
01654         self.assertEqual(record.rounds[1].alignments[16].hsps[0].match, "D I  VIG   SS +   ++I     I  IS  +T PEL+    Y +  R    DS Q   A   I+  +    ++ +  +  YGE G+    Q   + G   I     I    +  +F  +I R L+  N   V       ++ +I+  A+       F+  G +  G    S IA        AEG +  +PKR")
01655         self.assertEqual(record.rounds[1].alignments[16].hsps[0].sbjct, "DKISGVIGAAASSVSIMVANILRLFKIPQISYASTAPELSDNTRYDFFSRVVPPDSYQA-QAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISREIGGVCIAQSQKIPREPRPGEFEKIIKRLLETPNARAVIMFANEDDIRRILEAAKKLNQSGHFLWIGSDSWG----SKIAPVYQQEEIAEGAVTILPKR")
01656         self.assertEqual(record.rounds[1].alignments[16].hsps[0].query_start, 91)
01657         self.assertEqual(record.rounds[1].alignments[16].hsps[0].query_end, 274)
01658         self.assertEqual(record.rounds[1].alignments[16].hsps[0].sbjct_start, 145)
01659         self.assertEqual(record.rounds[1].alignments[16].hsps[0].sbjct_end, 335)
01660         self.assertEqual(record.rounds[1].alignments[17].hsps[0].query, "DGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQR-GYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGE-GLARSVQDGLKQGNANIVFFDGITAGEK--DFSALIAR-LQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFM--GPEGVGNASLSNIA-----GGAAEGMLVTMPKR")
01661         self.assertEqual(record.rounds[1].alignments[17].hsps[0].match, "D I  VIG   SS +   ++I     I  IS  +T PEL+    Y +  R    DS Q   A   I+  +    ++ +  +  YGE G+    Q   + G   I     I    +  +F  +I R L+  N   V       ++ +I+  A+       F+  G +  G    S IA        AEG +  +PKR")
01662         self.assertEqual(record.rounds[1].alignments[17].hsps[0].sbjct, "DKISGVIGAAASSVSIMVANILRLFKIPQISYASTAPELSDNTRYDFFSRVVPPDSYQA-QAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISREIGGVCIAQSQKIPREPRPGEFEKIIKRLLETPNARAVIMFANEDDIRRILEAAKKLNQSGHFLWIGSDSWG----SKIAPVYQQEEIAEGAVTILPKR")
01663         self.assertEqual(record.rounds[1].alignments[17].hsps[0].query_start, 91)
01664         self.assertEqual(record.rounds[1].alignments[17].hsps[0].query_end, 274)
01665         self.assertEqual(record.rounds[1].alignments[17].hsps[0].sbjct_start, 145)
01666         self.assertEqual(record.rounds[1].alignments[17].hsps[0].sbjct_end, 335)
01667         self.assertEqual(record.rounds[1].alignments[18].hsps[0].query, "DGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQR-GYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGE-GLARSVQDGLKQGNANIVFFDGITAGEK--DFSALIAR-LQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFM--GPEGVGNASLSNIA-----GGAAEGMLVTMPKR")
01668         self.assertEqual(record.rounds[1].alignments[18].hsps[0].match, "D I  VIG   SS +   ++I     I  IS  +T PEL+    Y +  R    DS Q   A   I+  +    ++ +  +  YGE G+    Q   + G   I     I    +  +F  +I R L+  N   V       ++  I+  A+       F+  G +  G    S IA        AEG +  +PKR")
01669         self.assertEqual(record.rounds[1].alignments[18].hsps[0].sbjct, "DKISGVIGAAASSVSIMVANILRLFKIPQISYASTAPELSDNTRYDFFSRVVPPDSYQA-QAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISREIGGVCIAQSQKIPREPRPGEFEKIIKRLLETPNARAVIMFANEDDIRGILEAAKKLNQSGHFLWIGSDSWG----SKIAPVYQQEEIAEGAVTILPKR")
01670         self.assertEqual(record.rounds[1].alignments[18].hsps[0].query_start, 91)
01671         self.assertEqual(record.rounds[1].alignments[18].hsps[0].query_end, 274)
01672         self.assertEqual(record.rounds[1].alignments[18].hsps[0].sbjct_start, 145)
01673         self.assertEqual(record.rounds[1].alignments[18].hsps[0].sbjct_end, 335)
01674         self.assertEqual(record.rounds[1].alignments[19].hsps[0].query, "QRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSAL--IARLQKENIDFVY-YGGYYP")
01675         self.assertEqual(record.rounds[1].alignments[19].hsps[0].match, "+   I+ D      G+ + V D LK    N   +DG+       + L  +  L+  N DFV   GG  P")
01676         self.assertEqual(record.rounds[1].alignments[19].hsps[0].sbjct, "KNALIVSDAFMNKSGVVKQVADLLKAQGINSAVYDGVMPNPTVTAVLEGLKILKDNNSDFVISLGGGSP")
01677         self.assertEqual(record.rounds[1].alignments[19].hsps[0].query_start, 162)
01678         self.assertEqual(record.rounds[1].alignments[19].hsps[0].query_end, 227)
01679         self.assertEqual(record.rounds[1].alignments[19].hsps[0].sbjct_start, 32)
01680         self.assertEqual(record.rounds[1].alignments[19].hsps[0].sbjct_end, 100)
01681         self.assertEqual(record.rounds[1].alignments[20].hsps[0].query, "GPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSA")
01682         self.assertEqual(record.rounds[1].alignments[20].hsps[0].match, "G +G  + ++ + AG     +L  + K   +DP N  +V  +KA KK+     +W  Y   +  A A     ")
01683         self.assertEqual(record.rounds[1].alignments[20].hsps[0].sbjct, "GKQGEAHLAMRHYAGTVRYNVLNWLEKN--KDPLNDTVVSVMKASKKNDLLVEIWQDYTTQEEAAAAAKAGG")
01684         self.assertEqual(record.rounds[1].alignments[20].hsps[0].query_start, 247)
01685         self.assertEqual(record.rounds[1].alignments[20].hsps[0].query_end, 318)
01686         self.assertEqual(record.rounds[1].alignments[20].hsps[0].sbjct_start, 570)
01687         self.assertEqual(record.rounds[1].alignments[20].hsps[0].sbjct_end, 639)
01688         self.assertEqual(record.rounds[1].alignments[21].hsps[0].query, "MLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGDLKG")
01689         self.assertEqual(record.rounds[1].alignments[21].hsps[0].match, "+++T+P   ++  AN ++     +++ D S  Y+  T      L T +    S       +  +      + GP+  D+ GD+  ")
01690         self.assertEqual(record.rounds[1].alignments[21].hsps[0].sbjct, "LVLTLPP--EKFIANASVSGRFPSERSDFSLAYLEGTLLFGHMLQTFLENGESVTTPKFARAFRNLTFQGLEGPVTLDDSGDIDN")
01691         self.assertEqual(record.rounds[1].alignments[21].hsps[0].query_start, 267)
01692         self.assertEqual(record.rounds[1].alignments[21].hsps[0].query_end, 351)
01693         self.assertEqual(record.rounds[1].alignments[21].hsps[0].sbjct_start, 294)
01694         self.assertEqual(record.rounds[1].alignments[21].hsps[0].sbjct_end, 376)
01695         self.assertEqual(record.rounds[1].alignments[22].hsps[0].query, "TVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSALIARLQK")
01696         self.assertEqual(record.rounds[1].alignments[22].hsps[0].match, " +K ++ +++  K   G+G+ R  +    +  A +    G+   +++   L A L+K")
01697         self.assertEqual(record.rounds[1].alignments[22].hsps[0].sbjct, "RIKEEKASVVRPK---GDGVVRIQKQTSGRKGAGVSVITGLDLSDEELKKLAAELKK")
01698         self.assertEqual(record.rounds[1].alignments[22].hsps[0].query_start, 158)
01699         self.assertEqual(record.rounds[1].alignments[22].hsps[0].query_end, 214)
01700         self.assertEqual(record.rounds[1].alignments[22].hsps[0].sbjct_start, 14)
01701         self.assertEqual(record.rounds[1].alignments[22].hsps[0].sbjct_end, 67)
01702         self.assertEqual(record.rounds[1].alignments[23].hsps[0].query, "AIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGE-KDFSALIARLQKENIDFVYYGGYYPE-MGQIVRQARANGL")
01703         self.assertEqual(record.rounds[1].alignments[23].hsps[0].match, "AI  D Q Y  G+ + VQD  K  +  +   +    G+    S  +  L   N+D +           + VR+A   G+")
01704         self.assertEqual(record.rounds[1].alignments[23].hsps[0].sbjct, "AIYLDTQGYYAGVRQGVQDAAKDSSVQVQLIETNAQGDISKESTFVDTLVARNVDAIILSAVSENGSSRTVRRASEAGI")
01705         self.assertEqual(record.rounds[1].alignments[23].hsps[0].query_start, 165)
01706         self.assertEqual(record.rounds[1].alignments[23].hsps[0].query_end, 241)
01707         self.assertEqual(record.rounds[1].alignments[23].hsps[0].sbjct_start, 35)
01708         self.assertEqual(record.rounds[1].alignments[23].hsps[0].sbjct_end, 113)
01709         self.assertEqual(record.rounds[2].alignments[0].hsps[0].query, "RKAKTIIAGIVALAVSQGAMADDIKVAIVGAMSGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGDLKGFEFGVFQWHADGSSTVAK")
01710         self.assertEqual(record.rounds[2].alignments[0].hsps[0].match, " K KT++AG +AL++S  A ADDIKVA+VGAMSGPVAQ+GD EF GA QAI DINAKGGIKGDKLV V+YDDACDPKQAVAVANK+VNDGI+YVIGHLCSSSTQPASDIYEDEGILMI+P AT PELT RGY+ ++RT GLDS QGPTAAKYILE VKPQRIAIIHDKQQYGEGLAR+VQDGLK+G  N+VFFDGITAGEKDFS L+ARL+KENIDFVYYGGY+PEMGQI+RQ+RA GLKTQFMGPEGV N SLSNIAG +AEG+LVT PK YDQ PANK IV+A+KA K+DPSG +VW TYAA+QSL   +  S    P ++ K LK    DTV+GPL WDEKGDLKGFEFGVF WHA+G++T AK")
01711         self.assertEqual(record.rounds[2].alignments[0].hsps[0].sbjct, "MKGKTLLAGCIALSLSHMAFADDIKVAVVGAMSGPVAQYGDQEFTGAEQAIADINAKGGIKGDKLVAVKYDDACDPKQAVAVANKVVNDGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATAPELTARGYKLVLRTTGLDSDQGPTAAKYILEKVKPQRIAIIHDKQQYGEGLARAVQDGLKKGGVNVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQSRAAGLKTQFMGPEGVANVSLSNIAGESAEGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNHSD--DPAEIAKYLKGATVDTVMGPLSWDEKGDLKGFEFGVFDWHANGTATDAK")
01712         self.assertEqual(record.rounds[2].alignments[0].hsps[0].query_start, 3)
01713         self.assertEqual(record.rounds[2].alignments[0].hsps[0].query_end, 369)
01714         self.assertEqual(record.rounds[2].alignments[0].hsps[0].sbjct_start, 1)
01715         self.assertEqual(record.rounds[2].alignments[0].hsps[0].sbjct_end, 365)
01716         self.assertEqual(record.rounds[2].alignments[1].hsps[0].query, "MKRKAKTIIAGIVALAVSQGAMADDIKVAIVGAMSGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGDLKGFEFGVFQWHADGSSTVAK")
01717         self.assertEqual(record.rounds[2].alignments[1].hsps[0].match, "MKR AKTIIAG++ALA+S  AMADDIKVA+VGAMSGP+AQWG MEFNGA QAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGI+YVIGHLCSSSTQPASDIYEDEGILMISPGAT PELTQRGYQ+IMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLK  NAN+VFFDGITAGEKDFSALIARL+KENIDFVYYGGYYPEMGQ++RQAR+ GLKTQFMGPEGVGNASLSNIAG AAEGMLVTMPKRYDQDPAN+ IV+ALKADKKDPSGPYVWITYAAVQSLATA+ R+ S  PL LVKDLKANGA+TVIGPL WDEKGDLKGF+FGVFQWHADGSST AK")
01718         self.assertEqual(record.rounds[2].alignments[1].hsps[0].sbjct, "MKRNAKTIIAGMIALAISHTAMADDIKVAVVGAMSGPIAQWGIMEFNGAEQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATAPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTAAK")
01719         self.assertEqual(record.rounds[2].alignments[1].hsps[0].query_start, 1)
01720         self.assertEqual(record.rounds[2].alignments[1].hsps[0].query_end, 369)
01721         self.assertEqual(record.rounds[2].alignments[1].hsps[0].sbjct_start, 1)
01722         self.assertEqual(record.rounds[2].alignments[1].hsps[0].sbjct_end, 369)
01723         self.assertEqual(record.rounds[2].alignments[2].hsps[0].query, "MKRKAKTIIAGIVALAVSQGAMADDIKVAIVGAMSGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGDLKGFEFGVFQWHADGSSTVAK")
01724         self.assertEqual(record.rounds[2].alignments[2].hsps[0].match, "M  K K ++AG++ALA S  A+A+DIKVA+VGAMSGPVAQ+GD EF GA QA+ DINAKGGIKG+KL   +YDDACDPKQAVAVANK+VNDGI+YVIGHLCSSSTQPASDIYEDEGILMI+P AT PELT RGYQ I+RT GLDS QGPTAAKYILE VKPQRIAI+HDKQQYGEGLAR+VQDGLK+GNAN+VFFDGITAGEKDFS L+ARL+KENIDFVYYGGY+PEMGQI+RQARA GLKTQFMGPEGV N SLSNIAG +AEG+LVT PK YDQ PANK IV+A+KA K+DPSG +VW TYAA+QSL   + +S    P ++ K LKAN  DTV+GPL WDEKGDLKGFEFGVF WHA+G++T AK")
01725         self.assertEqual(record.rounds[2].alignments[2].hsps[0].sbjct, "MNTKGKALLAGLIALAFSNMALAEDIKVAVVGAMSGPVAQYGDQEFTGAEQAVADINAKGGIKGNKLQIAKYDDACDPKQAVAVANKVVNDGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATAPELTARGYQLILRTTGLDSDQGPTAAKYILEKVKPQRIAIVHDKQQYGEGLARAVQDGLKKGNANVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNIAGESAEGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSD--DPAEIAKYLKANSVDTVMGPLTWDEKGDLKGFEFGVFDWHANGTATDAK")
01726         self.assertEqual(record.rounds[2].alignments[2].hsps[0].query_start, 1)
01727         self.assertEqual(record.rounds[2].alignments[2].hsps[0].query_end, 369)
01728         self.assertEqual(record.rounds[2].alignments[2].hsps[0].sbjct_start, 1)
01729         self.assertEqual(record.rounds[2].alignments[2].hsps[0].sbjct_end, 367)
01730         self.assertEqual(record.rounds[2].alignments[3].hsps[0].query, "MKRKAKTIIAGIVALAVSQGAMADDIKVAIVGAMSGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGDLKGFEFGVFQWHADGSSTVAK")
01731         self.assertEqual(record.rounds[2].alignments[3].hsps[0].match, "M  K K ++AG +AL++S  A A DIKVA+VGAMSGPVAQ+GD EF GA QAI DINAKGG+KGDKLV V+YDDACDPKQAVAVANK+VNDGI+YVIGHLCSSSTQPASDIYEDEGILMI+P AT PELT RGY  ++RT GLDS QGPTAAKYI+E VKP+RIAI+HDKQQYGEGLARSVQD LK+ NA++VFFDGITAGEKDFS L+ARL+KENIDFVYYGGY+PEMGQI+RQARA GLKTQFMGPEGV N SLSNIAG +AEG+LVT PK YDQ PANK IV+A+KA K+DPSG +VW TYAA+QSL   + +S    P ++ K LKAN  +TV+GPL WD KGDLKGFEFGVF WHA+G++T AK")
01732         self.assertEqual(record.rounds[2].alignments[3].hsps[0].sbjct, "MNMKGKALLAGCIALSLSNMAFAKDIKVAVVGAMSGPVAQYGDQEFTGAEQAIADINAKGGVKGDKLVMVKYDDACDPKQAVAVANKVVNDGIKYVIGHLCSSSTQPASDIYEDEGILMITPAATAPELTARGYNLVLRTTGLDSDQGPTAAKYIVEKVKPKRIAIVHDKQQYGEGLARSVQDNLKKANADVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNIAGESAEGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSD--DPAEIAKYLKANSVETVMGPLSWDAKGDLKGFEFGVFDWHANGTATDAK")
01733         self.assertEqual(record.rounds[2].alignments[3].hsps[0].query_start, 1)
01734         self.assertEqual(record.rounds[2].alignments[3].hsps[0].query_end, 369)
01735         self.assertEqual(record.rounds[2].alignments[3].hsps[0].sbjct_start, 1)
01736         self.assertEqual(record.rounds[2].alignments[3].hsps[0].sbjct_end, 367)
01737         self.assertEqual(record.rounds[2].alignments[4].hsps[0].query, "MKRKAKTIIAGIVALAVSQGAMADDIKVAIVGAMSGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGDLKGFEFGVFQWHADGSSTVAK")
01738         self.assertEqual(record.rounds[2].alignments[4].hsps[0].match, "MKRKAKTIIAGIVALAVSQGAMADDIKVAIVGAMSGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGDLKGFEFGVFQWHADGSSTVAK")
01739         self.assertEqual(record.rounds[2].alignments[4].hsps[0].sbjct, "MKRKAKTIIAGIVALAVSQGAMADDIKVAIVGAMSGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGDLKGFEFGVFQWHADGSSTVAK")
01740         self.assertEqual(record.rounds[2].alignments[4].hsps[0].query_start, 1)
01741         self.assertEqual(record.rounds[2].alignments[4].hsps[0].query_end, 369)
01742         self.assertEqual(record.rounds[2].alignments[4].hsps[0].sbjct_start, 1)
01743         self.assertEqual(record.rounds[2].alignments[4].hsps[0].sbjct_end, 369)
01744         self.assertEqual(record.rounds[2].alignments[5].hsps[0].query, "KRKAKTIIAGIVALAVSQGAMADDIKVAIVGAMSGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQIVRQARANGLKTQFMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGDLKGFEFGVFQWHADGSSTVAK")
01745         self.assertEqual(record.rounds[2].alignments[5].hsps[0].match, "+R ++   A  +A   S    AD IK+A+ G ++GPVAQ+GDM+  GA  AI+ IN  GG+ G +L GV YDDACDPKQAVAVANK+VNDG+++V+GH+CSSSTQPA+DIYEDEG+LMI+P AT PE+T RGY+ I RT GLD+ QGP A K+I E  K + IA++HDKQQYGEG+A  V+  ++     +  F+G+ AG+KDF+ALI++L+K  + FVY+GGY+PEMG ++RQA+  GL  +FMGPEGVGN+ ++ IAG A+EGML T+P+ ++QDP NKA+++A KA  +DPSG +V   Y+AV  +A  + ++    P  + + L+AN  +T  G L +DEKGDLK F+F V++WH D + T  K")
01746         self.assertEqual(record.rounds[2].alignments[5].hsps[0].sbjct, "QRLSRLFAAMAIAGFASYSMAADTIKIALAGPVTGPVAQYGDMQRAGALMAIEQINKAGGVNGAQLEGVIYDDACDPKQAVAVANKVVNDGVKFVVGHVCSSSTQPATDIYEDEGVLMITPSATAPEITSRGYKLIFRTIGLDNMQGPVAGKFIAERYKVKTIAVLHDKQQYGEGIATEVKKTVEDAGIKVAVFEGLNAGDKDFNALISKLKKAGVQFVYFGGYHPEMGLLLRQAKQAGLDARFMGPEGVGNSEITAIAGDASEGMLATLPRAFEQDPKNKALIDAFKAKNQDPSGIFVLPAYSAVTVIAKGIEKAGEADPEKVAEALRANTFETPTGNLGFDEKGDLKNFDFTVYEWHKDATRTEVK")
01747         self.assertEqual(record.rounds[2].alignments[5].hsps[0].query_start, 2)
01748         self.assertEqual(record.rounds[2].alignments[5].hsps[0].query_end, 369)
01749         self.assertEqual(record.rounds[2].alignments[5].hsps[0].sbjct_start, 6)
01750         self.assertEqual(record.rounds[2].alignments[5].hsps[0].sbjct_end, 373)
01751         self.assertEqual(record.rounds[2].alignments[6].hsps[0].query, "SGPVAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIV-NDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIV--FFDGITAGEKDFSALIARLQKENIDFVYYGGYYPEMGQIVRQ-ARANGLKTQ-FMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQD-PANKAIVEALKADKKDPSGPYVW--ITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGP")
01752         self.assertEqual(record.rounds[2].alignments[6].hsps[0].match, "+G  A        GA  A++ +N +GG+ G  +  +  D   DP +    A   + N G+++++G   S + +    + E    L+  P  T  E  +     +      + +  P AA  I      +R+  I     Y       ++   +Q    ++   +  +   + D    + R+ +   D V+         ++ R  AR  G   +  +       A ++ +    AEG +V  P     D PA++A V+A      + +    W    Y     L  A   + + R  D+ + L     D   GP")
01753         self.assertEqual(record.rounds[2].alignments[6].hsps[0].sbjct, "TGVTADIERSHAYGALLAVEQLNREGGVGGRPIETLSQDPGGDPDRYRLCAEDFIRNRGVRFLVGCYMSHTRKAVMPVVERADALLCYP--TPYEGFEYSPNIVYGGPAPNQNSAPLAAYLI--RHYGERVVFIGSDYIYPRESNHVMRHLYRQHGGTVLEEIYIPLYPSDDDLQRAVERIYQARADVVFSTVVGTGTAELYRAIARRYGDGRRPPIASLTTSEAEVAKMESDVAEGQVVVAPYFSSIDTPASRAFVQACHGFFPENATITAWAEAAYWQTLLLGRAAQAAGNWRVEDVQRHLYDIDIDAPQGP")
01754         self.assertEqual(record.rounds[2].alignments[6].hsps[0].query_start, 35)
01755         self.assertEqual(record.rounds[2].alignments[6].hsps[0].query_end, 340)
01756         self.assertEqual(record.rounds[2].alignments[6].hsps[0].sbjct_start, 17)
01757         self.assertEqual(record.rounds[2].alignments[6].hsps[0].sbjct_end, 326)
01758         self.assertEqual(record.rounds[2].alignments[7].hsps[0].query, "NGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELT-QRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIV---FFDGITAGEKDFSALIARLQKE-NIDFVYYGGYYPEMGQIVRQARANGLKTQFM----GPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWIT")
01759         self.assertEqual(record.rounds[2].alignments[7].hsps[0].match, "    QA+  + A    +GD            P    A   ++V      V+G   SS +   +++     I  IS  +T PEL+    Y +  R    DS Q   A   I+  +    ++ +  +  YGE    +     ++     +             +FS +I RL +  N   +       ++ +++  AR   L   F+       G   + + ++    A G +  +PKR   D       +       + +   +W  ")
01760         self.assertEqual(record.rounds[2].alignments[7].hsps[0].sbjct, "YALEQALSFVQALIRGRGDGDEVGVRCPGGVPPLRPAPPERVVA-----VVGASASSVSIMVANVLRLFAIPQISYASTAPELSDSTRYDFFSRVVPPDSYQA-QAMVDIVRALGWNYVSTLASEGNYGESGVEAFVQISREAGGVCIAQSIKIPREPKPGEFSKVIRRLMETPNARGIIIFANEDDIRRVLEAARQANLTGHFLWVGSDSWGAKTSPILSLE-DVAVGAITILPKRASID----GFDQYFMTRSLENNRRNIWFA")
01761         self.assertEqual(record.rounds[2].alignments[7].hsps[0].query_start, 47)
01762         self.assertEqual(record.rounds[2].alignments[7].hsps[0].query_end, 303)
01763         self.assertEqual(record.rounds[2].alignments[7].hsps[0].sbjct_start, 104)
01764         self.assertEqual(record.rounds[2].alignments[7].hsps[0].sbjct_end, 358)
01765         self.assertEqual(record.rounds[2].alignments[8].hsps[0].query, "VIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGE-GLARSVQDGLKQGNANIV--FFDGITAGEKDFSALIAR-LQKENIDFVYYGGYYPEMGQIVRQARANGLKTQF--MGPEGVGN--ASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWIT")
01766         self.assertEqual(record.rounds[2].alignments[8].hsps[0].match, "VIG   SS +   ++I     I  IS  +T P+L+               +    A   I+  +K   ++ +  +  YGE G+   +Q   + G   I             +F  +I R L+  N   V       ++ +++  AR       F  MG +  G+  A + ++    AEG +  +PKR       +       +   D +   +W  ")
01767         self.assertEqual(record.rounds[2].alignments[8].hsps[0].sbjct, "VIGASGSSVSIMVANILRLFKIPQISYASTAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTVASEGSYGESGVEAFIQKSREDGGVCIAQSVKIPREPKAGEFDKIIRRLLETSNARAVIIFANEDDIRRVLEAARRANQTGHFFWMGSDSWGSKIAPVLHLE-EVAEGAVTILPKRMSV----RGFDRYFSSRTLDNNRRNIWFA")
01768         self.assertEqual(record.rounds[2].alignments[8].hsps[0].query_start, 96)
01769         self.assertEqual(record.rounds[2].alignments[8].hsps[0].query_end, 303)
01770         self.assertEqual(record.rounds[2].alignments[8].hsps[0].sbjct_start, 153)
01771         self.assertEqual(record.rounds[2].alignments[8].hsps[0].sbjct_end, 363)
01772         self.assertEqual(record.rounds[2].alignments[9].hsps[0].query, "VIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRG-YQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFD--GITAGEKDFSALIARL-QKENIDFVYYGGYYPEMGQIVRQARANGLKTQF--MGPEGVG-NASLSNIAGGAAEGMLVT")
01773         self.assertEqual(record.rounds[2].alignments[9].hsps[0].match, "VIG   SS +   +++     I  +SP +T   L+ +  +    RT   D+ Q   A   IL+      ++ IH +  YGE    ++     + N  I   +     A +K F ++I++L +K N   V       +  +I++ A+   L   F  +  +G G    L       AEG +  ")
01774         self.assertEqual(record.rounds[2].alignments[9].hsps[0].sbjct, "VIGGSYSSVSLQVANLLRLFHIPQVSPASTAKTLSDKTRFDLFARTVPPDTFQS-VALVDILKNFNWSYVSTIHSEGSYGEYGIEALHKEATERNVCIAVAEKVPSAADDKVFDSIISKLQKKPNARGVVLFTRAEDARRILQAAKRANLSQPFHWIASDGWGKQQKLLEGLEDIAEGAITV")
01775         self.assertEqual(record.rounds[2].alignments[9].hsps[0].query_start, 96)
01776         self.assertEqual(record.rounds[2].alignments[9].hsps[0].query_end, 270)
01777         self.assertEqual(record.rounds[2].alignments[9].hsps[0].sbjct_start, 152)
01778         self.assertEqual(record.rounds[2].alignments[9].hsps[0].sbjct_end, 332)
01779         self.assertEqual(record.rounds[2].alignments[10].hsps[0].query, "VIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGE-GLARSVQDGLKQGNANIV--FFDGITAGEKDFSALIAR-LQKENIDFVYYGGYYPEMGQIVRQARANGLKTQF--MGPEGVGNASLSNIA-GGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWIT")
01780         self.assertEqual(record.rounds[2].alignments[10].hsps[0].match, "VIG   SS +   ++I     I  IS  +T P+L+               +    A   I+  +K   ++ +  +  YGE G+   +Q   + G   I             +F  +I R L+  N   +       ++ +++  AR       F  MG +  G+ S   +     AEG +  +PKR       +       +   D +   +W  ")
01781         self.assertEqual(record.rounds[2].alignments[10].hsps[0].sbjct, "VIGASGSSVSIMVANILRLFKIPQISYASTAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTLASEGSYGESGVEAFIQKSRENGGVCIAQSVKIPREPKTGEFDKIIKRLLETSNARGIIIFANEDDIRRVLEAARRANQTGHFFWMGSDSWGSKSAPVLRLEEVAEGAVTILPKRMSV----RGFDRYFSSRTLDNNRRNIWFA")
01782         self.assertEqual(record.rounds[2].alignments[10].hsps[0].query_start, 96)
01783         self.assertEqual(record.rounds[2].alignments[10].hsps[0].query_end, 303)
01784         self.assertEqual(record.rounds[2].alignments[10].hsps[0].sbjct_start, 153)
01785         self.assertEqual(record.rounds[2].alignments[10].hsps[0].sbjct_end, 363)
01786         self.assertEqual(record.rounds[2].alignments[11].hsps[0].query, "NGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELT-QRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIV---FFDGITAGEKDFSALIARLQKE-NIDFVYYGGYYPEMGQIVRQARANGLKTQFM----GPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWIT")
01787         self.assertEqual(record.rounds[2].alignments[11].hsps[0].match, "    QA+  + A    +GD            P    A   ++V      V+G   SS +   +++     I  IS  +T PEL+    Y +  R    DS Q   A   I+  +    ++ +  +  YGE    +     ++     +             +F  +I RL +  N   +       ++ +++   R   L   F+       G   + + N+    A G +  +PKR   D       +       + +   +W  ")
01788         self.assertEqual(record.rounds[2].alignments[11].hsps[0].sbjct, "YALEQALSFVQALIRGRGDGDEASVRCPGGVPPLRSAPPERVVA-----VVGASASSVSIMVANVLRLFAIPQISYASTAPELSDSTRYDFFSRVVPPDSYQA-QAMVDIVRALGWNYVSTLASEGNYGESGVEAFVQISREAGGVCIAQSIKIPREPKPGEFHKVIRRLMETPNARGIIIFANEDDIRRVLEATRQANLTGHFLWVGSDSWGSKISPILNLE-EEAVGAITILPKRASID----GFDQYFMTRSLENNRRNIWFA")
01789         self.assertEqual(record.rounds[2].alignments[11].hsps[0].query_start, 47)
01790         self.assertEqual(record.rounds[2].alignments[11].hsps[0].query_end, 303)
01791         self.assertEqual(record.rounds[2].alignments[11].hsps[0].sbjct_start, 98)
01792         self.assertEqual(record.rounds[2].alignments[11].hsps[0].sbjct_end, 352)
01793         self.assertEqual(record.rounds[2].alignments[12].hsps[0].query, "DGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRG-YQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFF---DGITAGEKDFSALIAR-LQKENIDFVYYGGYYPEMGQIVRQARANGLKTQF--MGPEGVGNASLSNI--AGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWIT")
01794         self.assertEqual(record.rounds[2].alignments[12].hsps[0].match, "D I  VIG   SS +   ++I     I  IS  +T PEL+    Y +  R    DS Q   A   I+  +    ++ +  +  YGE    +     ++     +             +F  +I R L+  N   V       ++ +I+  A+       F  +G +  G + ++ +      AEG +  +PKR   D  ++       A+ +      VW  ")
01795         self.assertEqual(record.rounds[2].alignments[12].hsps[0].sbjct, "DKISGVIGAAASSVSIMVANILRLFKIPQISYASTAPELSDNTRYDFFSRVVPPDSYQA-QAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISREIGGVCIAQSQKIPREPRPGEFEKIIKRLLETPNARAVIMFANEDDIRRILEAAKKLNQSGHFLWIGSDSWG-SKIAPVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRN----VWFA")
01796         self.assertEqual(record.rounds[2].alignments[12].hsps[0].query_start, 91)
01797         self.assertEqual(record.rounds[2].alignments[12].hsps[0].query_end, 303)
01798         self.assertEqual(record.rounds[2].alignments[12].hsps[0].sbjct_start, 145)
01799         self.assertEqual(record.rounds[2].alignments[12].hsps[0].sbjct_end, 360)
01800         self.assertEqual(record.rounds[2].alignments[13].hsps[0].query, "DGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRG-YQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFF---DGITAGEKDFSALIAR-LQKENIDFVYYGGYYPEMGQIVRQARANGLKTQF--MGPEGVGNASLSNI--AGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWIT")
01801         self.assertEqual(record.rounds[2].alignments[13].hsps[0].match, "D I  VIG   SS +   ++I     I  IS  +T PEL+    Y +  R    DS Q   A   I+  +    ++ +  +  YGE    +     ++     +             +F  +I R L+  N   V       ++ +I+  A+       F  +G +  G + ++ +      AEG +  +PKR   D  ++       A+ +      VW  ")
01802         self.assertEqual(record.rounds[2].alignments[13].hsps[0].sbjct, "DKISGVIGAAASSVSIMVANILRLFKIPQISYASTAPELSDNTRYDFFSRVVPPDSYQA-QAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISREIGGVCIAQSQKIPREPRPGEFEKIIKRLLETPNARAVIMFANEDDIRRILEAAKKLNQSGHFLWIGSDSWG-SKIAPVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRN----VWFA")
01803         self.assertEqual(record.rounds[2].alignments[13].hsps[0].query_start, 91)
01804         self.assertEqual(record.rounds[2].alignments[13].hsps[0].query_end, 303)
01805         self.assertEqual(record.rounds[2].alignments[13].hsps[0].sbjct_start, 145)
01806         self.assertEqual(record.rounds[2].alignments[13].hsps[0].sbjct_end, 360)
01807         self.assertEqual(record.rounds[2].alignments[14].hsps[0].query, "DGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRG-YQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFF---DGITAGEKDFSALIAR-LQKENIDFVYYGGYYPEMGQIVRQARANGLKTQF--MGPEGVGNASLSNI--AGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWIT")
01808         self.assertEqual(record.rounds[2].alignments[14].hsps[0].match, "D I  VIG   SS +   ++I     I  IS  +T PEL+    Y +  R    DS Q   A   I+  +    ++ +  +  YGE    +     ++     +             +F  +I R L+  N   V       ++  I+  A+       F  +G +  G + ++ +      AEG +  +PKR   D  ++       A+ +      VW  ")
01809         self.assertEqual(record.rounds[2].alignments[14].hsps[0].sbjct, "DKISGVIGAAASSVSIMVANILRLFKIPQISYASTAPELSDNTRYDFFSRVVPPDSYQA-QAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISREIGGVCIAQSQKIPREPRPGEFEKIIKRLLETPNARAVIMFANEDDIRGILEAAKKLNQSGHFLWIGSDSWG-SKIAPVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRN----VWFA")
01810         self.assertEqual(record.rounds[2].alignments[14].hsps[0].query_start, 91)
01811         self.assertEqual(record.rounds[2].alignments[14].hsps[0].query_end, 303)
01812         self.assertEqual(record.rounds[2].alignments[14].hsps[0].sbjct_start, 145)
01813         self.assertEqual(record.rounds[2].alignments[14].hsps[0].sbjct_end, 360)
01814         self.assertEqual(record.rounds[2].alignments[15].hsps[0].query, "DGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDG----------LKQGNANIVFFDGITA-GEKDFS----ALIARLQKENIDFVYYGGYYPEMGQIVR-QARANGLKTQFMGPEGVGNASLSNIAGG-AAEGMLVTMPKRYDQDPANKAIVEALKADKKD")
01815         self.assertEqual(record.rounds[2].alignments[15].hsps[0].match, "DG   V  H   SS    S  Y D G  M +   T   + Q      +        QGP A      T +  ++ I  +   Y        +DG          +K  N     +  +T   E DF       + R+ +E+++F+      P    I R +  ++  + QF  PE  G   +        + G      K YD   AN   +  +   K +")
01816         self.assertEqual(record.rounds[2].alignments[15].hsps[0].sbjct, "DGHMVVRSHARVSSLTLKSIQYRDAGEYMCTASNT---IGQDSQSIDLEFQYAPKLQGPVAVY----TWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDRVEPYSSTAQVQFDEPEATGGVPILKYKAEWKSLGEESWHFKWYDAKEANMEGIVTIMGLKPE")
01817         self.assertEqual(record.rounds[2].alignments[15].hsps[0].query_start, 91)
01818         self.assertEqual(record.rounds[2].alignments[15].hsps[0].query_end, 294)
01819         self.assertEqual(record.rounds[2].alignments[15].hsps[0].sbjct_start, 357)
01820         self.assertEqual(record.rounds[2].alignments[15].hsps[0].sbjct_end, 570)
01821         self.assertEqual(record.rounds[2].alignments[16].hsps[0].query, "VIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGIT--AGEKDFSALIARLQK--ENIDFVYYGGYYPEMGQIVRQARANGLKTQFM")
01822         self.assertEqual(record.rounds[2].alignments[16].hsps[0].match, "VIG   SS      ++ +   I  I+  AT+ +L+ +             +Q   A   I++      ++ +H +  YGE    + +D   +    I     I   AGE+ F  L+ +L+        V        +  ++   R  GL  +F+")
01823         self.assertEqual(record.rounds[2].alignments[16].hsps[0].sbjct, "VIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGICIAHSYKIYSNAGEQSFDKLLKKLRSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFL")
01824         self.assertEqual(record.rounds[2].alignments[16].hsps[0].query_start, 96)
01825         self.assertEqual(record.rounds[2].alignments[16].hsps[0].query_end, 246)
01826         self.assertEqual(record.rounds[2].alignments[16].hsps[0].sbjct_start, 145)
01827         self.assertEqual(record.rounds[2].alignments[16].hsps[0].sbjct_end, 299)
01828         self.assertEqual(record.rounds[2].alignments[17].hsps[0].query, "IVALAVSQGAMADDIKVAIVGAMSGPVAQWGDMEFNGARQAIKDINAKGGIKGDKL--VGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGITAGE")
01829         self.assertEqual(record.rounds[2].alignments[17].hsps[0].match, "++ L  S  A +   KV ++G  +             AR A   +N    + G     V +  +    P    AV++ +    +  ++G +  ++ +PA  + ++ G+ ++  G                T     +    A   +L+  +  R+A+I   Q       R++   L+     +     +   +")
01830         self.assertEqual(record.rounds[2].alignments[17].hsps[0].sbjct, "LLLLLPSPSAFSAVFKVGVLGPWACDPIFARARPDLAARLATDRLNRDLALDGGPWFEVTLLPEPCLTPGSLGAVSSALTR--VSGLVGPVNPAACRPAELLAQEAGVALVPWGCPGTRAA--------GTTAPAVTPAADALYVLLKAFRWARVALITAPQDLWVEAGRALSTALRARGLPVALVTSMVPSD")
01831         self.assertEqual(record.rounds[2].alignments[17].hsps[0].query_start, 12)
01832         self.assertEqual(record.rounds[2].alignments[17].hsps[0].query_end, 202)
01833         self.assertEqual(record.rounds[2].alignments[17].hsps[0].sbjct_start, 43)
01834         self.assertEqual(record.rounds[2].alignments[17].hsps[0].sbjct_end, 225)
01835         self.assertEqual(record.rounds[2].alignments[18].hsps[0].query, "VIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKQGNANIVFFDGIT--AGEKDFSALIARLQK--ENIDFVYYGGYYPEMGQIVRQARANGLKTQFM")
01836         self.assertEqual(record.rounds[2].alignments[18].hsps[0].match, "VIG   SS      ++ +   I  I+  AT+ +L+ +             +Q   A   I++      ++ +H +  YGE    + +D   +    I     I   AGE+ F  L+ +L         V        +  ++   R  GL  +F+")
01837         self.assertEqual(record.rounds[2].alignments[18].hsps[0].sbjct, "VIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGICIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFL")
01838         self.assertEqual(record.rounds[2].alignments[18].hsps[0].query_start, 96)
01839         self.assertEqual(record.rounds[2].alignments[18].hsps[0].query_end, 246)
01840         self.assertEqual(record.rounds[2].alignments[18].hsps[0].sbjct_start, 146)
01841         self.assertEqual(record.rounds[2].alignments[18].hsps[0].sbjct_end, 300)
01842         self.assertEqual(record.rounds[2].alignments[19].hsps[0].query, "DINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETV")
01843         self.assertEqual(record.rounds[2].alignments[19].hsps[0].match, "D+N + G +G       Y  AC   +   +     N     V+   CS +  PA DI + EG  +   G    E      Q I+ T G D  + P       E  ")
01844         self.assertEqual(record.rounds[2].alignments[19].hsps[0].sbjct, "DMNWEKG-EGQPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGCSIN--PAIDIGQIEGAFIQGMGLYTIEELNYSPQGILHTRGPDQYKIPAICDMPTELH")
01845         self.assertEqual(record.rounds[2].alignments[19].hsps[0].query_start, 55)
01846         self.assertEqual(record.rounds[2].alignments[19].hsps[0].query_end, 159)
01847         self.assertEqual(record.rounds[2].alignments[19].hsps[0].sbjct_start, 1148)
01848         self.assertEqual(record.rounds[2].alignments[19].hsps[0].sbjct_end, 1249)
01849         self.assertEqual(record.rounds[2].alignments[20].hsps[0].query, "AGIVALAVSQGAMADDIKVAI---VGAMSGPVAQWGDMEFNGARQAIKDINAKGG")
01850         self.assertEqual(record.rounds[2].alignments[20].hsps[0].match, "A   A   S   +   I  AI    G+ +GPV Q+ +   NG+  A       GG")
01851         self.assertEqual(record.rounds[2].alignments[20].hsps[0].sbjct, "AAAAAGEASHVVVGGSIDAAIDTAKGSRAGPVEQYVNQAANGSLIAAASALVAGG")
01852         self.assertEqual(record.rounds[2].alignments[20].hsps[0].query_start, 10)
01853         self.assertEqual(record.rounds[2].alignments[20].hsps[0].query_end, 61)
01854         self.assertEqual(record.rounds[2].alignments[20].hsps[0].sbjct_start, 315)
01855         self.assertEqual(record.rounds[2].alignments[20].hsps[0].sbjct_end, 369)
01856         self.assertEqual(record.rounds[2].alignments[21].hsps[0].query, "DGIQYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQYIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDG----------LKQGNANIVFFDGITA-GEKDFS----ALIARLQKENIDFVYYGGYYPEMGQIVR-QARANGLKTQFMGPEGVGNASLSNIAGG")
01857         self.assertEqual(record.rounds[2].alignments[21].hsps[0].match, "DG   V  H   SS    S  Y D G  M +   T   + Q      +        QGP A      T +  ++ I  +   Y        +DG          +K  N     +  +T   E DF       + R+ +E+++F+      P    I R +  ++  + QF  PE  G   +      ")
01858         self.assertEqual(record.rounds[2].alignments[21].hsps[0].sbjct, "DGHMVVRSHARVSSLTLKSIQYRDAGEYMCTASNT---IGQDSQSIDLEFQYAPKLQGPVAVY----TWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDRVEPYSSTAQVQFDEPEATGGVPILKYKAE")
01859         self.assertEqual(record.rounds[2].alignments[21].hsps[0].query_start, 91)
01860         self.assertEqual(record.rounds[2].alignments[21].hsps[0].query_end, 262)
01861         self.assertEqual(record.rounds[2].alignments[21].hsps[0].sbjct_start, 357)
01862         self.assertEqual(record.rounds[2].alignments[21].hsps[0].sbjct_end, 537)
01863         self.assertEqual(record.rounds[2].alignments[22].hsps[0].query, "IARLQKENIDFVYYGGYYPEMGQ-----IVRQARANGLKTQFMGPEGVGNASLSNIAGGAAEGMLVTMPKRYDQDPANKAIVEALKADKKDPSGPYVWITYAAVQSLATAMTRSASHRPLDLVKDLKANGADTVIGPLKWDEKGDL")
01864         self.assertEqual(record.rounds[2].alignments[22].hsps[0].match, "I +++K   + V + G     G+     + + A   G+ +    PE    + LS +A       +  M    + DP + A  +      ++  G    + Y  V +L        +     + K L+  GA  V      D+ G+L")
01865         self.assertEqual(record.rounds[2].alignments[22].hsps[0].sbjct, "IEKMKKTGRNIVVFYGSQTGTGEEFANRLSKDAHRYGMGSMAADPEEYDMSELSRLAEIGNSLAIFCMATYGEGDPTDNA--QDFYDWLQETDGQLSGVNY-PVFALGDKTYEHYNAMGAYVDKRLEELGAKRVFDLGMGDDDGNL")
01866         self.assertEqual(record.rounds[2].alignments[22].hsps[0].query_start, 209)
01867         self.assertEqual(record.rounds[2].alignments[22].hsps[0].query_end, 349)
01868         self.assertEqual(record.rounds[2].alignments[22].hsps[0].sbjct_start, 15)
01869         self.assertEqual(record.rounds[2].alignments[22].hsps[0].sbjct_end, 157)

Here is the caller graph for this function:

def test_NCBITextParser.TestNCBITextParser._check_bt007_round0 (   self,
  record 
) [private]

Definition at line 746 of file test_NCBITextParser.py.

00746 
00747     def _check_bt007_round0(self, record):
00748         self.assertEqual(record.rounds[0].new_seqs[0].title, "gi|126343|sp|P17216|LIVK_SALTY LEUCINE-SPECIFIC BINDING PROTEIN...")
00749         self.assertEqual(record.rounds[0].new_seqs[0].score, 743)
00750         self.assertAlmostEqual(record.rounds[0].new_seqs[0].e, 0.0)
00751         self.assertEqual(record.rounds[0].new_seqs[1].title, "gi|126349|sp|P04816|LIVK_ECOLI LEUCINE-SPECIFIC BINDING PROTEIN...")
00752         self.assertEqual(record.rounds[0].new_seqs[1].score, 679)
00753         self.assertAlmostEqual(record.rounds[0].new_seqs[1].e, 0.0)
00754         self.assertEqual(record.rounds[0].new_seqs[2].title, "gi|126348|sp|P02917|LIVJ_ECOLI LEU/ILE/VAL-BINDING PROTEIN PREC...")
00755         self.assertEqual(record.rounds[0].new_seqs[2].score, 581)
00756         self.assertAlmostEqual(record.rounds[0].new_seqs[2].e, 1.e-166)
00757         self.assertEqual(record.rounds[0].new_seqs[3].title, "gi|126342|sp|P17215|LIVJ_SALTY LEU/ILE/VAL/THR-BINDING PROTEIN ...")
00758         self.assertEqual(record.rounds[0].new_seqs[3].score, 577)
00759         self.assertAlmostEqual(record.rounds[0].new_seqs[3].e, 1.e-164)
00760         self.assertEqual(record.rounds[0].new_seqs[4].title, "gi|126347|sp|P25399|LIVJ_CITFR LEU/ILE/VAL-BINDING PROTEIN PREC...")
00761         self.assertEqual(record.rounds[0].new_seqs[4].score, 570)
00762         self.assertAlmostEqual(record.rounds[0].new_seqs[4].e, 1.e-162)
00763         self.assertEqual(record.rounds[0].new_seqs[5].title, "gi|115120|sp|P21175|BRAC_PSEAE LEUCINE-, ISOLEUCINE-, VALINE-, ...")
00764         self.assertEqual(record.rounds[0].new_seqs[5].score, 413)
00765         self.assertAlmostEqual(record.rounds[0].new_seqs[5].e, 1.e-115)
00766         self.assertEqual(record.rounds[0].new_seqs[6].title, "gi|113709|sp|P27017|AMIC_PSEAE ALIPHATIC AMIDASE EXPRESSION-REG...")
00767         self.assertEqual(record.rounds[0].new_seqs[6].score, 40)
00768         self.assertAlmostEqual(record.rounds[0].new_seqs[6].e, 0.006)
00769         self.assertEqual(record.rounds[0].new_seqs[7].title, "gi|127751|sp|P02567|MYSD_CAEEL MYOSIN HEAVY CHAIN D (MHC D)")
00770         self.assertEqual(record.rounds[0].new_seqs[7].score, 32)
00771         self.assertAlmostEqual(record.rounds[0].new_seqs[7].e, 1.4)
00772         self.assertEqual(record.rounds[0].new_seqs[8].title, "gi|131068|sp|P23596|PRTD_ERWCH PROTEASES SECRETION ATP-BINDING ...")
00773         self.assertEqual(record.rounds[0].new_seqs[8].score, 32)
00774         self.assertAlmostEqual(record.rounds[0].new_seqs[8].e, 1.8)
00775         self.assertEqual(record.rounds[0].new_seqs[9].title, "gi|2495081|sp|Q09630|MGR1_CAEEL PROBABLE METABOTROPIC GLUTAMATE...")
00776         self.assertEqual(record.rounds[0].new_seqs[9].score, 32)
00777         self.assertAlmostEqual(record.rounds[0].new_seqs[9].e, 1.8)
00778         self.assertEqual(record.rounds[0].new_seqs[10].title, "gi|2506848|sp|P80040|MDH_CHLAU MALATE DEHYDROGENASE")
00779         self.assertEqual(record.rounds[0].new_seqs[10].score, 32)
00780         self.assertAlmostEqual(record.rounds[0].new_seqs[10].e, 1.8)
00781         self.assertEqual(record.rounds[0].new_seqs[11].title, "gi|3915245|sp|Q38394|VG37_BPK3 TAIL FIBER PROTEIN GP37 (RECEPTO...")
00782         self.assertEqual(record.rounds[0].new_seqs[11].score, 31)
00783         self.assertAlmostEqual(record.rounds[0].new_seqs[11].e, 4.0)
00784         self.assertEqual(record.rounds[0].new_seqs[12].title, "gi|1351210|sp|P47209|TCPE_CAEEL T-COMPLEX PROTEIN 1, EPSILON SU...")
00785         self.assertEqual(record.rounds[0].new_seqs[12].score, 31)
00786         self.assertAlmostEqual(record.rounds[0].new_seqs[12].e, 4.0)
00787         self.assertEqual(record.rounds[0].new_seqs[13].title, "gi|1351310|sp|P43496|TRXB_PENCH THIOREDOXIN REDUCTASE")
00788         self.assertEqual(record.rounds[0].new_seqs[13].score, 31)
00789         self.assertAlmostEqual(record.rounds[0].new_seqs[13].e, 5.2)
00790         self.assertEqual(len(record.rounds[0].alignments), 14)
00791         self.assertEqual(record.rounds[0].alignments[0].title, ">gi|126343|sp|P17216|LIVK_SALTY LEUCINE-SPECIFIC BINDING PROTEIN PRECURSOR (LS-BP) (L-BP)")
00792         self.assertEqual(record.rounds[0].alignments[0].length, 369)
00793         self.assertEqual(record.rounds[0].alignments[1].title, ">gi|126349|sp|P04816|LIVK_ECOLI LEUCINE-SPECIFIC BINDING PROTEIN PRECURSOR (LS-BP) (L-BP)")
00794         self.assertEqual(record.rounds[0].alignments[1].length, 369)
00795         self.assertEqual(record.rounds[0].alignments[2].title, ">gi|126348|sp|P02917|LIVJ_ECOLI LEU/ILE/VAL-BINDING PROTEIN PRECURSOR (LIV-BP)")
00796         self.assertEqual(record.rounds[0].alignments[2].length, 367)
00797         self.assertEqual(record.rounds[0].alignments[3].title, ">gi|126342|sp|P17215|LIVJ_SALTY LEU/ILE/VAL/THR-BINDING PROTEIN PRECURSOR (LIVT-BP)")
00798         self.assertEqual(record.rounds[0].alignments[3].length, 365)
00799         self.assertEqual(record.rounds[0].alignments[4].title, ">gi|126347|sp|P25399|LIVJ_CITFR LEU/ILE/VAL-BINDING PROTEIN PRECURSOR (LIV-BP)")
00800         self.assertEqual(record.rounds[0].alignments[4].length, 367)
00801         self.assertEqual(record.rounds[0].alignments[5].title, ">gi|115120|sp|P21175|BRAC_PSEAE LEUCINE-, ISOLEUCINE-, VALINE-, THREONINE-, AND ALANINE-BINDING PROTEIN PRECURSOR (LIVAT-BP) (LEU/ILE/VAL/THR/ALA-BINDING PROTEIN)")
00802         self.assertEqual(record.rounds[0].alignments[5].length, 373)
00803         self.assertEqual(record.rounds[0].alignments[6].title, ">gi|113709|sp|P27017|AMIC_PSEAE ALIPHATIC AMIDASE EXPRESSION-REGULATING PROTEIN")
00804         self.assertEqual(record.rounds[0].alignments[6].length, 385)
00805         self.assertEqual(record.rounds[0].alignments[7].title, ">gi|127751|sp|P02567|MYSD_CAEEL MYOSIN HEAVY CHAIN D (MHC D)")
00806         self.assertEqual(record.rounds[0].alignments[7].length, 1938)
00807         self.assertEqual(record.rounds[0].alignments[8].title, ">gi|131068|sp|P23596|PRTD_ERWCH PROTEASES SECRETION ATP-BINDING PROTEIN PRTD")
00808         self.assertEqual(record.rounds[0].alignments[8].length, 575)
00809         self.assertEqual(record.rounds[0].alignments[9].title, ">gi|2495081|sp|Q09630|MGR1_CAEEL PROBABLE METABOTROPIC GLUTAMATE RECEPTOR MGL-1")
00810         self.assertEqual(record.rounds[0].alignments[9].length, 999)
00811         self.assertEqual(record.rounds[0].alignments[10].title, ">gi|2506848|sp|P80040|MDH_CHLAU MALATE DEHYDROGENASE")
00812         self.assertEqual(record.rounds[0].alignments[10].length, 309)
00813         self.assertEqual(record.rounds[0].alignments[11].title, ">gi|3915245|sp|Q38394|VG37_BPK3 TAIL FIBER PROTEIN GP37 (RECEPTOR RECOGNIZING PROTEIN)")
00814         self.assertEqual(record.rounds[0].alignments[11].length, 1243)
00815         self.assertEqual(record.rounds[0].alignments[12].title, ">gi|1351210|sp|P47209|TCPE_CAEEL T-COMPLEX PROTEIN 1, EPSILON SUBUNIT (TCP-1-EPSILON) (CCT-EPSILON)")
00816         self.assertEqual(record.rounds[0].alignments[12].length, 542)
00817         self.assertEqual(record.rounds[0].alignments[13].title, ">gi|1351310|sp|P43496|TRXB_PENCH THIOREDOXIN REDUCTASE")
00818         self.assertEqual(record.rounds[0].alignments[13].length, 334)

Here is the caller graph for this function:

def test_NCBITextParser.TestNCBITextParser._check_bt007_round1 (   self,
  record 
) [private]

Definition at line 819 of file test_NCBITextParser.py.

00819 
00820     def _check_bt007_round1(self, record):
00821         self.assertEqual(len(record.rounds[1].new_seqs), 18)
00822         self.assertEqual(record.rounds[1].new_seqs[0].title, "gi|113709|sp|P27017|AMIC_PSEAE ALIPHATIC AMIDASE EXPRESSION-REG...")
00823         self.assertEqual(record.rounds[1].new_seqs[0].score, 49)
00824         self.assertAlmostEqual(record.rounds[1].new_seqs[0].e, 2e-5)
00825         self.assertEqual(record.rounds[1].new_seqs[1].title, "gi|3024131|sp|P91685|MGR_DROME METABOTROPIC GLUTAMATE RECEPTOR ...")
00826         self.assertEqual(record.rounds[1].new_seqs[1].score, 41)
00827         self.assertAlmostEqual(record.rounds[1].new_seqs[1].e, 0.003)
00828         self.assertEqual(record.rounds[1].new_seqs[2].title, "gi|121300|sp|P23385|MGR1_RAT METABOTROPIC GLUTAMATE RECEPTOR 1 ...")
00829         self.assertEqual(record.rounds[1].new_seqs[2].score, 39)
00830         self.assertAlmostEqual(record.rounds[1].new_seqs[2].e, 0.012)
00831         self.assertEqual(record.rounds[1].new_seqs[3].title, "gi|2495074|sp|Q13255|MGR1_HUMAN METABOTROPIC GLUTAMATE RECEPTOR...")
00832         self.assertEqual(record.rounds[1].new_seqs[3].score, 39)
00833         self.assertAlmostEqual(record.rounds[1].new_seqs[3].e, 0.012)
00834         self.assertEqual(record.rounds[1].new_seqs[4].title, "gi|1170947|sp|P31424|MGR5_RAT METABOTROPIC GLUTAMATE RECEPTOR 5...")
00835         self.assertEqual(record.rounds[1].new_seqs[4].score, 36)
00836         self.assertAlmostEqual(record.rounds[1].new_seqs[4].e, 0.11)
00837         self.assertEqual(record.rounds[1].new_seqs[5].title, "gi|1709020|sp|P41594|MGR5_HUMAN METABOTROPIC GLUTAMATE RECEPTOR...")
00838         self.assertEqual(record.rounds[1].new_seqs[5].score, 36)
00839         self.assertAlmostEqual(record.rounds[1].new_seqs[5].e, 0.14)
00840         self.assertEqual(record.rounds[1].new_seqs[6].title, "gi|2495081|sp|Q09630|MGR1_CAEEL PROBABLE METABOTROPIC GLUTAMATE...")
00841         self.assertEqual(record.rounds[1].new_seqs[6].score, 35)
00842         self.assertAlmostEqual(record.rounds[1].new_seqs[6].e, 0.18)
00843         self.assertEqual(record.rounds[1].new_seqs[7].title, "gi|6014748|sp|Q10900|CTPI_MYCTU PROBABLE CATION-TRANSPORTING AT...")
00844         self.assertEqual(record.rounds[1].new_seqs[7].score, 33)
00845         self.assertAlmostEqual(record.rounds[1].new_seqs[7].e, 0.71)
00846         self.assertEqual(record.rounds[1].new_seqs[8].title, "gi|2833574|sp|Q58178|Y768_METJA HYPOTHETICAL PROTEIN MJ0768")
00847         self.assertEqual(record.rounds[1].new_seqs[8].score, 32)
00848         self.assertAlmostEqual(record.rounds[1].new_seqs[8].e, 1.6)
00849         self.assertEqual(record.rounds[1].new_seqs[9].title, "gi|1169299|sp|P45513|DHAT_CITFR 1,3-PROPANEDIOL DEHYDROGENASE (...")
00850         self.assertEqual(record.rounds[1].new_seqs[9].score, 31)
00851         self.assertAlmostEqual(record.rounds[1].new_seqs[9].e, 3.6)
00852         self.assertEqual(record.rounds[1].new_seqs[10].title, "gi|2495080|sp|P70579|MGR8_RAT METABOTROPIC GLUTAMATE RECEPTOR 8...")
00853         self.assertEqual(record.rounds[1].new_seqs[10].score, 31)
00854         self.assertAlmostEqual(record.rounds[1].new_seqs[10].e, 3.6)
00855         self.assertEqual(record.rounds[1].new_seqs[11].title, "gi|2495079|sp|O00222|MGR8_HUMAN METABOTROPIC GLUTAMATE RECEPTOR...")
00856         self.assertEqual(record.rounds[1].new_seqs[11].score, 31)
00857         self.assertAlmostEqual(record.rounds[1].new_seqs[11].e, 3.6)
00858         self.assertEqual(record.rounds[1].new_seqs[12].title, "gi|1346533|sp|P47743|MGR8_MOUSE METABOTROPIC GLUTAMATE RECEPTOR...")
00859         self.assertEqual(record.rounds[1].new_seqs[12].score, 30)
00860         self.assertAlmostEqual(record.rounds[1].new_seqs[12].e, 6.2)
00861         self.assertEqual(record.rounds[1].new_seqs[13].title, "gi|113381|sp|P06758|ADH2_ZYMMO ALCOHOL DEHYDROGENASE II (ADH II)")
00862         self.assertEqual(record.rounds[1].new_seqs[13].score, 30)
00863         self.assertAlmostEqual(record.rounds[1].new_seqs[13].e, 8.1)
00864         self.assertEqual(record.rounds[1].new_seqs[14].title, "gi|127751|sp|P02567|MYSD_CAEEL MYOSIN HEAVY CHAIN D (MHC D)")
00865         self.assertEqual(record.rounds[1].new_seqs[14].score, 30)
00866         self.assertAlmostEqual(record.rounds[1].new_seqs[14].e, 8.1)
00867         self.assertEqual(record.rounds[1].new_seqs[15].title, "gi|1346321|sp|P23897|HSER_RAT HEAT-STABLE ENTEROTOXIN RECEPTOR ...")
00868         self.assertEqual(record.rounds[1].new_seqs[15].score, 30)
00869         self.assertAlmostEqual(record.rounds[1].new_seqs[15].e, 8.1)
00870         self.assertEqual(record.rounds[1].new_seqs[16].title, "gi|1175674|sp|P45116|YCIH_HAEIN HYPOTHETICAL PROTEIN HI1225")
00871         self.assertEqual(record.rounds[1].new_seqs[16].score, 30)
00872         self.assertAlmostEqual(record.rounds[1].new_seqs[16].e, 8.1)
00873         self.assertEqual(record.rounds[1].new_seqs[17].title, "gi|3025270|sp|P77269|YPHF_ECOLI ABC TRANSPORTER PERIPLASMIC BIN...")
00874         self.assertEqual(record.rounds[1].new_seqs[17].score, 30)
00875         self.assertAlmostEqual(record.rounds[1].new_seqs[17].e, 8.1)
00876         self.assertEqual(len(record.rounds[1].alignments), 24)
00877         self.assertEqual(record.rounds[1].alignments[0].title, ">gi|126349|sp|P04816|LIVK_ECOLI LEUCINE-SPECIFIC BINDING PROTEIN PRECURSOR (LS-BP) (L-BP)")
00878         self.assertEqual(record.rounds[1].alignments[0].length, 369)
00879         self.assertEqual(record.rounds[1].alignments[1].title, ">gi|126342|sp|P17215|LIVJ_SALTY LEU/ILE/VAL/THR-BINDING PROTEIN PRECURSOR (LIVT-BP)")
00880         self.assertEqual(record.rounds[1].alignments[1].length, 365)
00881         self.assertEqual(record.rounds[1].alignments[2].title, ">gi|126347|sp|P25399|LIVJ_CITFR LEU/ILE/VAL-BINDING PROTEIN PRECURSOR (LIV-BP)")
00882         self.assertEqual(record.rounds[1].alignments[2].length, 367)
00883         self.assertEqual(record.rounds[1].alignments[3].title, ">gi|126343|sp|P17216|LIVK_SALTY LEUCINE-SPECIFIC BINDING PROTEIN PRECURSOR (LS-BP) (L-BP)")
00884         self.assertEqual(record.rounds[1].alignments[3].length, 369)
00885         self.assertEqual(record.rounds[1].alignments[4].title, ">gi|126348|sp|P02917|LIVJ_ECOLI LEU/ILE/VAL-BINDING PROTEIN PRECURSOR (LIV-BP)")
00886         self.assertEqual(record.rounds[1].alignments[4].length, 367)
00887         self.assertEqual(record.rounds[1].alignments[5].title, ">gi|115120|sp|P21175|BRAC_PSEAE LEUCINE-, ISOLEUCINE-, VALINE-, THREONINE-, AND ALANINE-BINDING PROTEIN PRECURSOR (LIVAT-BP) (LEU/ILE/VAL/THR/ALA-BINDING PROTEIN)")
00888         self.assertEqual(record.rounds[1].alignments[5].length, 373)
00889         self.assertEqual(record.rounds[1].alignments[6].title, ">gi|113709|sp|P27017|AMIC_PSEAE ALIPHATIC AMIDASE EXPRESSION-REGULATING PROTEIN")
00890         self.assertEqual(record.rounds[1].alignments[6].length, 385)
00891         self.assertEqual(record.rounds[1].alignments[7].title, ">gi|3024131|sp|P91685|MGR_DROME METABOTROPIC GLUTAMATE RECEPTOR PRECURSOR")
00892         self.assertEqual(record.rounds[1].alignments[7].length, 976)
00893         self.assertEqual(record.rounds[1].alignments[8].title, ">gi|121300|sp|P23385|MGR1_RAT METABOTROPIC GLUTAMATE RECEPTOR 1 PRECURSOR")
00894         self.assertEqual(record.rounds[1].alignments[8].length, 1199)
00895         self.assertEqual(record.rounds[1].alignments[9].title, ">gi|2495074|sp|Q13255|MGR1_HUMAN METABOTROPIC GLUTAMATE RECEPTOR 1 PRECURSOR")
00896         self.assertEqual(record.rounds[1].alignments[9].length, 1194)
00897         self.assertEqual(record.rounds[1].alignments[10].title, ">gi|1170947|sp|P31424|MGR5_RAT METABOTROPIC GLUTAMATE RECEPTOR 5 PRECURSOR")
00898         self.assertEqual(record.rounds[1].alignments[10].length, 1203)
00899         self.assertEqual(record.rounds[1].alignments[11].title, ">gi|1709020|sp|P41594|MGR5_HUMAN METABOTROPIC GLUTAMATE RECEPTOR 5 PRECURSOR")
00900         self.assertEqual(record.rounds[1].alignments[11].length, 1212)
00901         self.assertEqual(record.rounds[1].alignments[12].title, ">gi|2495081|sp|Q09630|MGR1_CAEEL PROBABLE METABOTROPIC GLUTAMATE RECEPTOR MGL-1")
00902         self.assertEqual(record.rounds[1].alignments[12].length, 999)
00903         self.assertEqual(record.rounds[1].alignments[13].title, ">gi|6014748|sp|Q10900|CTPI_MYCTU PROBABLE CATION-TRANSPORTING ATPASE I")
00904         self.assertEqual(record.rounds[1].alignments[13].length, 1632)
00905         self.assertEqual(record.rounds[1].alignments[14].title, ">gi|2833574|sp|Q58178|Y768_METJA HYPOTHETICAL PROTEIN MJ0768")
00906         self.assertEqual(record.rounds[1].alignments[14].length, 249)
00907         self.assertEqual(record.rounds[1].alignments[15].title, ">gi|1169299|sp|P45513|DHAT_CITFR 1,3-PROPANEDIOL DEHYDROGENASE (3-HYDROXYPROPIONALDEHYDE REDUCTASE) (1,3-PROPANEDIOL OXIDOREDUCTASE)")
00908         self.assertEqual(record.rounds[1].alignments[15].length, 387)
00909         self.assertEqual(record.rounds[1].alignments[16].title, ">gi|2495080|sp|P70579|MGR8_RAT METABOTROPIC GLUTAMATE RECEPTOR 8 PRECURSOR")
00910         self.assertEqual(record.rounds[1].alignments[16].length, 908)
00911         self.assertEqual(record.rounds[1].alignments[17].title, ">gi|2495079|sp|O00222|MGR8_HUMAN METABOTROPIC GLUTAMATE RECEPTOR 8 PRECURSOR")
00912         self.assertEqual(record.rounds[1].alignments[17].length, 908)
00913         self.assertEqual(record.rounds[1].alignments[18].title, ">gi|1346533|sp|P47743|MGR8_MOUSE METABOTROPIC GLUTAMATE RECEPTOR 8 PRECURSOR")
00914         self.assertEqual(record.rounds[1].alignments[18].length, 908)
00915         self.assertEqual(record.rounds[1].alignments[19].title, ">gi|113381|sp|P06758|ADH2_ZYMMO ALCOHOL DEHYDROGENASE II (ADH II)")
00916         self.assertEqual(record.rounds[1].alignments[19].length, 383)
00917         self.assertEqual(record.rounds[1].alignments[20].title, ">gi|127751|sp|P02567|MYSD_CAEEL MYOSIN HEAVY CHAIN D (MHC D)")
00918         self.assertEqual(record.rounds[1].alignments[20].length, 1938)
00919         self.assertEqual(record.rounds[1].alignments[21].title, ">gi|1346321|sp|P23897|HSER_RAT HEAT-STABLE ENTEROTOXIN RECEPTOR PRECURSOR (GC-C) (INTESTINAL GUANYLATE CYCLASE) (STA RECEPTOR)")
00920         self.assertEqual(record.rounds[1].alignments[21].length, 1072)
00921         self.assertEqual(record.rounds[1].alignments[22].title, ">gi|1175674|sp|P45116|YCIH_HAEIN HYPOTHETICAL PROTEIN HI1225")
00922         self.assertEqual(record.rounds[1].alignments[22].length, 106)
00923         self.assertEqual(record.rounds[1].alignments[23].title, ">gi|3025270|sp|P77269|YPHF_ECOLI ABC TRANSPORTER PERIPLASMIC BINDING PROTEIN YPHF PRECURSOR")

Here is the caller graph for this function:

def test_NCBITextParser.TestNCBITextParser._check_bt007_round2 (   self,
  record 
) [private]

Definition at line 924 of file test_NCBITextParser.py.

00924 
00925     def _check_bt007_round2(self, record):
00926         self.assertEqual(record.rounds[1].alignments[23].length, 327)
00927         self.assertEqual(len(record.rounds[2].new_seqs), 16)
00928         self.assertEqual(record.rounds[2].new_seqs[0].title, "gi|3024134|sp|O15303|MGR6_HUMAN METABOTROPIC GLUTAMATE RECEPTOR...")
00929         self.assertEqual(record.rounds[2].new_seqs[0].score, 42)
00930         self.assertAlmostEqual(record.rounds[2].new_seqs[0].e, 0.002)
00931         self.assertEqual(record.rounds[2].new_seqs[1].title, "gi|2495077|sp|Q14833|MGR4_HUMAN METABOTROPIC GLUTAMATE RECEPTOR...")
00932         self.assertEqual(record.rounds[2].new_seqs[1].score, 39)
00933         self.assertAlmostEqual(record.rounds[2].new_seqs[1].e, 0.012)
00934         self.assertEqual(record.rounds[2].new_seqs[2].title, "gi|3024131|sp|P91685|MGR_DROME METABOTROPIC GLUTAMATE RECEPTOR ...")
00935         self.assertEqual(record.rounds[2].new_seqs[2].score, 38)
00936         self.assertAlmostEqual(record.rounds[2].new_seqs[2].e, 0.021)
00937         self.assertEqual(record.rounds[2].new_seqs[3].title, "gi|400255|sp|P31423|MGR4_RAT METABOTROPIC GLUTAMATE RECEPTOR 4 ...")
00938         self.assertEqual(record.rounds[2].new_seqs[3].score, 38)
00939         self.assertAlmostEqual(record.rounds[2].new_seqs[3].e, 0.036)
00940         self.assertEqual(record.rounds[2].new_seqs[4].title, "gi|547903|sp|P35349|MGR6_RAT METABOTROPIC GLUTAMATE RECEPTOR 6 ...")
00941         self.assertEqual(record.rounds[2].new_seqs[4].score, 37)
00942         self.assertAlmostEqual(record.rounds[2].new_seqs[4].e, 0.047)
00943         self.assertEqual(record.rounds[2].new_seqs[5].title, "gi|2495080|sp|P70579|MGR8_RAT METABOTROPIC GLUTAMATE RECEPTOR 8...")
00944         self.assertEqual(record.rounds[2].new_seqs[5].score, 36)
00945         self.assertAlmostEqual(record.rounds[2].new_seqs[5].e, 0.10)
00946         self.assertEqual(record.rounds[2].new_seqs[6].title, "gi|2495079|sp|O00222|MGR8_HUMAN METABOTROPIC GLUTAMATE RECEPTOR...")
00947         self.assertEqual(record.rounds[2].new_seqs[6].score, 36)
00948         self.assertAlmostEqual(record.rounds[2].new_seqs[6].e, 0.10)
00949         self.assertEqual(record.rounds[2].new_seqs[7].title, "gi|1346533|sp|P47743|MGR8_MOUSE METABOTROPIC GLUTAMATE RECEPTOR...")
00950         self.assertEqual(record.rounds[2].new_seqs[7].score, 35)
00951         self.assertAlmostEqual(record.rounds[2].new_seqs[7].e, 0.18)
00952         self.assertEqual(record.rounds[2].new_seqs[8].title, "gi|400402|sp|P13595|NCA1_MOUSE NEURAL CELL ADHESION MOLECULE, L...")
00953         self.assertEqual(record.rounds[2].new_seqs[8].score, 33)
00954         self.assertAlmostEqual(record.rounds[2].new_seqs[8].e, 0.69)
00955         self.assertEqual(record.rounds[2].new_seqs[9].title, "gi|1170947|sp|P31424|MGR5_RAT METABOTROPIC GLUTAMATE RECEPTOR 5...")
00956         self.assertEqual(record.rounds[2].new_seqs[9].score, 33)
00957         self.assertAlmostEqual(record.rounds[2].new_seqs[9].e, 0.69)
00958         self.assertEqual(record.rounds[2].new_seqs[10].title, "gi|1706242|sp|P51840|CYGE_RAT GUANYLYL CYCLASE GC-E PRECURSOR (...")
00959         self.assertEqual(record.rounds[2].new_seqs[10].score, 33)
00960         self.assertAlmostEqual(record.rounds[2].new_seqs[10].e, 0.91)
00961         self.assertEqual(record.rounds[2].new_seqs[11].title, "gi|1709020|sp|P41594|MGR5_HUMAN METABOTROPIC GLUTAMATE RECEPTOR...")
00962         self.assertEqual(record.rounds[2].new_seqs[11].score, 33)
00963         self.assertAlmostEqual(record.rounds[2].new_seqs[11].e, 0.91)
00964         self.assertEqual(record.rounds[2].new_seqs[12].title, "gi|549451|sp|Q06278|ADO_HUMAN ALDEHYDE OXIDASE")
00965         self.assertEqual(record.rounds[2].new_seqs[12].score, 32)
00966         self.assertAlmostEqual(record.rounds[2].new_seqs[12].e, 2.0)
00967         self.assertEqual(record.rounds[2].new_seqs[13].title, "gi|6014748|sp|Q10900|CTPI_MYCTU PROBABLE CATION-TRANSPORTING AT...")
00968         self.assertEqual(record.rounds[2].new_seqs[13].score, 32)
00969         self.assertAlmostEqual(record.rounds[2].new_seqs[13].e, 2.0)
00970         self.assertEqual(record.rounds[2].new_seqs[14].title, "gi|127861|sp|P13594|NCA2_MOUSE NEURAL CELL ADHESION MOLECULE, P...")
00971         self.assertEqual(record.rounds[2].new_seqs[14].score, 31)
00972         self.assertAlmostEqual(record.rounds[2].new_seqs[14].e, 2.7)
00973         self.assertEqual(record.rounds[2].new_seqs[15].title, "gi|127971|sp||NCPR_SALTR_1 [Segment 1 of 3] NADPH-CYTOCHROME P4...")
00974         self.assertEqual(record.rounds[2].new_seqs[15].score, 31)
00975         self.assertAlmostEqual(record.rounds[2].new_seqs[15].e, 3.5)
00976         self.assertEqual(len(record.rounds[2].alignments), 23)
00977         self.assertEqual(record.rounds[2].alignments[0].title, ">gi|126342|sp|P17215|LIVJ_SALTY LEU/ILE/VAL/THR-BINDING PROTEIN PRECURSOR (LIVT-BP)")
00978         self.assertEqual(record.rounds[2].alignments[0].length, 365)
00979         self.assertEqual(record.rounds[2].alignments[1].title, ">gi|126349|sp|P04816|LIVK_ECOLI LEUCINE-SPECIFIC BINDING PROTEIN PRECURSOR (LS-BP) (L-BP)")
00980         self.assertEqual(record.rounds[2].alignments[1].length, 369)
00981         self.assertEqual(record.rounds[2].alignments[2].title, ">gi|126348|sp|P02917|LIVJ_ECOLI LEU/ILE/VAL-BINDING PROTEIN PRECURSOR (LIV-BP)")
00982         self.assertEqual(record.rounds[2].alignments[2].length, 367)
00983         self.assertEqual(record.rounds[2].alignments[3].title, ">gi|126347|sp|P25399|LIVJ_CITFR LEU/ILE/VAL-BINDING PROTEIN PRECURSOR (LIV-BP)")
00984         self.assertEqual(record.rounds[2].alignments[3].length, 367)
00985         self.assertEqual(record.rounds[2].alignments[4].title, ">gi|126343|sp|P17216|LIVK_SALTY LEUCINE-SPECIFIC BINDING PROTEIN PRECURSOR (LS-BP) (L-BP)")
00986         self.assertEqual(record.rounds[2].alignments[4].length, 369)
00987         self.assertEqual(record.rounds[2].alignments[5].title, ">gi|115120|sp|P21175|BRAC_PSEAE LEUCINE-, ISOLEUCINE-, VALINE-, THREONINE-, AND ALANINE-BINDING PROTEIN PRECURSOR (LIVAT-BP) (LEU/ILE/VAL/THR/ALA-BINDING PROTEIN)")
00988         self.assertEqual(record.rounds[2].alignments[5].length, 373)
00989         self.assertEqual(record.rounds[2].alignments[6].title, ">gi|113709|sp|P27017|AMIC_PSEAE ALIPHATIC AMIDASE EXPRESSION-REGULATING PROTEIN")
00990         self.assertEqual(record.rounds[2].alignments[6].length, 385)
00991         self.assertEqual(record.rounds[2].alignments[7].title, ">gi|3024134|sp|O15303|MGR6_HUMAN METABOTROPIC GLUTAMATE RECEPTOR 6 PRECURSOR")
00992         self.assertEqual(record.rounds[2].alignments[7].length, 877)
00993         self.assertEqual(record.rounds[2].alignments[8].title, ">gi|2495077|sp|Q14833|MGR4_HUMAN METABOTROPIC GLUTAMATE RECEPTOR 4 PRECURSOR")
00994         self.assertEqual(record.rounds[2].alignments[8].length, 912)
00995         self.assertEqual(record.rounds[2].alignments[9].title, ">gi|3024131|sp|P91685|MGR_DROME METABOTROPIC GLUTAMATE RECEPTOR PRECURSOR")
00996         self.assertEqual(record.rounds[2].alignments[9].length, 976)
00997         self.assertEqual(record.rounds[2].alignments[10].title, ">gi|400255|sp|P31423|MGR4_RAT METABOTROPIC GLUTAMATE RECEPTOR 4 PRECURSOR")
00998         self.assertEqual(record.rounds[2].alignments[10].length, 912)
00999         self.assertEqual(record.rounds[2].alignments[11].title, ">gi|547903|sp|P35349|MGR6_RAT METABOTROPIC GLUTAMATE RECEPTOR 6 PRECURSOR")
01000         self.assertEqual(record.rounds[2].alignments[11].length, 871)
01001         self.assertEqual(record.rounds[2].alignments[12].title, ">gi|2495080|sp|P70579|MGR8_RAT METABOTROPIC GLUTAMATE RECEPTOR 8 PRECURSOR")
01002         self.assertEqual(record.rounds[2].alignments[12].length, 908)
01003         self.assertEqual(record.rounds[2].alignments[13].title, ">gi|2495079|sp|O00222|MGR8_HUMAN METABOTROPIC GLUTAMATE RECEPTOR 8 PRECURSOR")
01004         self.assertEqual(record.rounds[2].alignments[13].length, 908)
01005         self.assertEqual(record.rounds[2].alignments[14].title, ">gi|1346533|sp|P47743|MGR8_MOUSE METABOTROPIC GLUTAMATE RECEPTOR 8 PRECURSOR")
01006         self.assertEqual(record.rounds[2].alignments[14].length, 908)
01007         self.assertEqual(record.rounds[2].alignments[15].title, ">gi|400402|sp|P13595|NCA1_MOUSE NEURAL CELL ADHESION MOLECULE, LARGE ISOFORM PRECURSOR (N-CAM 180) (NCAM-180) [CONTAINS: N-CAM 140 (NCAM-140)]")
01008         self.assertEqual(record.rounds[2].alignments[15].length, 1115)
01009         self.assertEqual(record.rounds[2].alignments[16].title, ">gi|1170947|sp|P31424|MGR5_RAT METABOTROPIC GLUTAMATE RECEPTOR 5 PRECURSOR")
01010         self.assertEqual(record.rounds[2].alignments[16].length, 1203)
01011         self.assertEqual(record.rounds[2].alignments[17].title, ">gi|1706242|sp|P51840|CYGE_RAT GUANYLYL CYCLASE GC-E PRECURSOR (GUANYLATE CYCLASE 2E)")
01012         self.assertEqual(record.rounds[2].alignments[17].length, 1108)
01013         self.assertEqual(record.rounds[2].alignments[18].title, ">gi|1709020|sp|P41594|MGR5_HUMAN METABOTROPIC GLUTAMATE RECEPTOR 5 PRECURSOR")
01014         self.assertEqual(record.rounds[2].alignments[18].length, 1212)
01015         self.assertEqual(record.rounds[2].alignments[19].title, ">gi|549451|sp|Q06278|ADO_HUMAN ALDEHYDE OXIDASE")
01016         self.assertEqual(record.rounds[2].alignments[19].length, 1338)
01017         self.assertEqual(record.rounds[2].alignments[20].title, ">gi|6014748|sp|Q10900|CTPI_MYCTU PROBABLE CATION-TRANSPORTING ATPASE I")
01018         self.assertEqual(record.rounds[2].alignments[20].length, 1632)
01019         self.assertEqual(record.rounds[2].alignments[21].title, ">gi|127861|sp|P13594|NCA2_MOUSE NEURAL CELL ADHESION MOLECULE, PHOSPHATIDYLINOSITOL-LINKED ISOFORM PRECURSOR (N-CAM 120) (NCAM-120)")
01020         self.assertEqual(record.rounds[2].alignments[21].length, 725)
01021         self.assertEqual(record.rounds[2].alignments[22].title, ">gi|127971|sp||NCPR_SALTR_1 [Segment 1 of 3] NADPH-CYTOCHROME P450 REDUCTASE (CPR)")
01022         self.assertEqual(record.rounds[2].alignments[22].length, 426)

Here is the caller graph for this function:

def test_NCBITextParser.TestNCBITextParser._check_bt009_footer (   self,
  record 
) [private]

Definition at line 2905 of file test_NCBITextParser.py.

02905 
02906     def _check_bt009_footer(self, record):
02907         self.assertEqual(record.database_name, ['data/swissprot'])
02908         self.assertEqual(record.num_letters_in_database, [29652561])
02909         self.assertEqual(record.num_sequences_in_database, [82258])
02910         self.assertEqual(record.posted_date, [('Nov 15, 1999  2:55 PM',)])
02911         self.assertEqual(len(record.ka_params), 3)
02912         self.assertAlmostEqual(record.ka_params[0], 0.317)
02913         self.assertAlmostEqual(record.ka_params[1], 0.149)
02914         self.assertAlmostEqual(record.ka_params[2], 0.479)
02915         self.assertEqual(len(record.ka_params_gap), 3)
02916         self.assertAlmostEqual(record.ka_params_gap[0], 0.270)
02917         self.assertAlmostEqual(record.ka_params_gap[1], 0.0524)
02918         self.assertAlmostEqual(record.ka_params_gap[2], 0.230)
02919         self.assertEqual(record.matrix, 'BLOSUM62')
02920         self.assertEqual(record.gap_penalties, [11,1])
02921         self.assertEqual(record.num_hits, 23641501)
02922         self.assertEqual(record.num_sequences, 82258)
02923         self.assertEqual(record.num_extends, 1047546)
02924         self.assertEqual(record.num_good_extends, 2481)
02925         self.assertEqual(record.num_seqs_better_e, 54)
02926         self.assertEqual(record.hsps_no_gap, 48)
02927         self.assertEqual(record.hsps_prelim_gapped, 6)
02928         self.assertEqual(record.hsps_gapped, 56)
02929         self.assertEqual(record.query_length, 200)
02930         self.assertEqual(record.database_length, 29652561)
02931         self.assertEqual(record.effective_hsp_length, 50)
02932         self.assertEqual(record.effective_query_length, 150)
02933         self.assertEqual(record.effective_database_length, 25539661)
02934         self.assertEqual(record.effective_search_space, 3830949150)
02935         self.assertEqual(record.effective_search_space_used, 3830949150)
02936         self.assertEqual(record.threshold, 11)
02937         self.assertEqual(record.window_size, 40)
02938         self.assertEqual(len(record.dropoff_1st_pass), 2)
02939         self.assertEqual(record.dropoff_1st_pass[0], 16)
02940         self.assertAlmostEqual(record.dropoff_1st_pass[1], 7.3)
02941         self.assertEqual(len(record.gap_x_dropoff), 2)
02942         self.assertEqual(record.gap_x_dropoff[0], 38)
02943         self.assertAlmostEqual(record.gap_x_dropoff[1], 14.8)
02944         self.assertEqual(len(record.gap_x_dropoff_final), 2)
02945         self.assertEqual(record.gap_x_dropoff_final[0], 64)
02946         self.assertAlmostEqual(record.gap_x_dropoff_final[1], 24.9)
02947         self.assertEqual(len(record.gap_trigger), 2)
02948         self.assertEqual(record.gap_trigger[0], 41)
02949         self.assertAlmostEqual(record.gap_trigger[1], 21.5)
02950         self.assertEqual(len(record.blast_cutoff), 2)
02951         self.assertEqual(record.blast_cutoff[0], 63)
02952         self.assertAlmostEqual(record.blast_cutoff[1], 28.8)

Here is the caller graph for this function:

def test_NCBITextParser.TestNCBITextParser._check_bt009_hsps (   self,
  record 
) [private]

Definition at line 2149 of file test_NCBITextParser.py.

02149 
02150     def _check_bt009_hsps(self, record):
02151         self.assertAlmostEqual(record.rounds[0].alignments[0].hsps[0].bits, 409)
02152         self.assertAlmostEqual(record.rounds[0].alignments[0].hsps[0].expect, 1e-114)
02153         self.assertEqual(len(record.rounds[0].alignments[0].hsps), 1)
02154         self.assertEqual(record.rounds[0].alignments[1].hsps[0].score, 499)
02155         self.assertAlmostEqual(record.rounds[0].alignments[1].hsps[0].bits, 198)
02156         self.assertAlmostEqual(record.rounds[0].alignments[1].hsps[0].expect, 6e-51)
02157         self.assertEqual(len(record.rounds[0].alignments[1].hsps), 1)
02158         self.assertEqual(record.rounds[0].alignments[2].hsps[0].score, 492)
02159         self.assertAlmostEqual(record.rounds[0].alignments[2].hsps[0].bits, 196)
02160         self.assertAlmostEqual(record.rounds[0].alignments[2].hsps[0].expect, 4e-50)
02161         self.assertEqual(len(record.rounds[0].alignments[2].hsps), 1)
02162         self.assertEqual(record.rounds[0].alignments[3].hsps[0].score, 465)
02163         self.assertAlmostEqual(record.rounds[0].alignments[3].hsps[0].bits, 185)
02164         self.assertAlmostEqual(record.rounds[0].alignments[3].hsps[0].expect, 5e-47)
02165         self.assertEqual(len(record.rounds[0].alignments[3].hsps), 1)
02166         self.assertEqual(record.rounds[0].alignments[4].hsps[0].score, 455)
02167         self.assertAlmostEqual(record.rounds[0].alignments[4].hsps[0].bits, 181)
02168         self.assertAlmostEqual(record.rounds[0].alignments[4].hsps[0].expect, 8e-46)
02169         self.assertEqual(len(record.rounds[0].alignments[4].hsps), 1)
02170         self.assertEqual(record.rounds[0].alignments[5].hsps[0].score, 447)
02171         self.assertAlmostEqual(record.rounds[0].alignments[5].hsps[0].bits, 178)
02172         self.assertAlmostEqual(record.rounds[0].alignments[5].hsps[0].expect, 7e-45)
02173         self.assertEqual(len(record.rounds[0].alignments[5].hsps), 1)
02174         self.assertEqual(record.rounds[0].alignments[6].hsps[0].score, 447)
02175         self.assertAlmostEqual(record.rounds[0].alignments[6].hsps[0].bits, 178)
02176         self.assertAlmostEqual(record.rounds[0].alignments[6].hsps[0].expect, 7e-45)
02177         self.assertEqual(len(record.rounds[0].alignments[6].hsps), 1)
02178         self.assertEqual(record.rounds[0].alignments[7].hsps[0].score, 438)
02179         self.assertAlmostEqual(record.rounds[0].alignments[7].hsps[0].bits, 175)
02180         self.assertAlmostEqual(record.rounds[0].alignments[7].hsps[0].expect, 8e-44)
02181         self.assertEqual(len(record.rounds[0].alignments[7].hsps), 1)
02182         self.assertEqual(record.rounds[0].alignments[8].hsps[0].score, 437)
02183         self.assertAlmostEqual(record.rounds[0].alignments[8].hsps[0].bits, 174)
02184         self.assertAlmostEqual(record.rounds[0].alignments[8].hsps[0].expect, 1e-43)
02185         self.assertEqual(len(record.rounds[0].alignments[8].hsps), 1)
02186         self.assertEqual(record.rounds[0].alignments[9].hsps[0].score, 421)
02187         self.assertAlmostEqual(record.rounds[0].alignments[9].hsps[0].bits, 168)
02188         self.assertAlmostEqual(record.rounds[0].alignments[9].hsps[0].expect, 8e-42)
02189         self.assertEqual(len(record.rounds[0].alignments[9].hsps), 1)
02190         self.assertEqual(record.rounds[0].alignments[10].hsps[0].score, 418)
02191         self.assertAlmostEqual(record.rounds[0].alignments[10].hsps[0].bits, 167)
02192         self.assertAlmostEqual(record.rounds[0].alignments[10].hsps[0].expect, 2e-41)
02193         self.assertEqual(len(record.rounds[0].alignments[10].hsps), 1)
02194         self.assertEqual(record.rounds[0].alignments[11].hsps[0].score, 417)
02195         self.assertAlmostEqual(record.rounds[0].alignments[11].hsps[0].bits, 166)
02196         self.assertAlmostEqual(record.rounds[0].alignments[11].hsps[0].expect, 2e-41)
02197         self.assertEqual(len(record.rounds[0].alignments[11].hsps), 1)
02198         self.assertEqual(record.rounds[0].alignments[12].hsps[0].score, 382)
02199         self.assertAlmostEqual(record.rounds[0].alignments[12].hsps[0].bits, 153)
02200         self.assertAlmostEqual(record.rounds[0].alignments[12].hsps[0].expect, 3e-37)
02201         self.assertEqual(len(record.rounds[0].alignments[12].hsps), 1)
02202         self.assertEqual(record.rounds[0].alignments[13].hsps[0].score, 379)
02203         self.assertAlmostEqual(record.rounds[0].alignments[13].hsps[0].bits, 152)
02204         self.assertAlmostEqual(record.rounds[0].alignments[13].hsps[0].expect, 7e-37)
02205         self.assertEqual(len(record.rounds[0].alignments[13].hsps), 1)
02206         self.assertEqual(record.rounds[0].alignments[14].hsps[0].score, 378)
02207         self.assertAlmostEqual(record.rounds[0].alignments[14].hsps[0].bits, 151)
02208         self.assertAlmostEqual(record.rounds[0].alignments[14].hsps[0].expect, 9e-37)
02209         self.assertEqual(len(record.rounds[0].alignments[14].hsps), 1)
02210         self.assertEqual(record.rounds[0].alignments[15].hsps[0].score, 373)
02211         self.assertAlmostEqual(record.rounds[0].alignments[15].hsps[0].bits, 149)
02212         self.assertAlmostEqual(record.rounds[0].alignments[15].hsps[0].expect, 3e-36)
02213         self.assertEqual(len(record.rounds[0].alignments[15].hsps), 1)
02214         self.assertEqual(record.rounds[0].alignments[16].hsps[0].score, 339)
02215         self.assertAlmostEqual(record.rounds[0].alignments[16].hsps[0].bits, 136)
02216         self.assertAlmostEqual(record.rounds[0].alignments[16].hsps[0].expect, 3e-32)
02217         self.assertEqual(len(record.rounds[0].alignments[16].hsps), 1)
02218         self.assertEqual(record.rounds[0].alignments[17].hsps[0].score, 318)
02219         self.assertAlmostEqual(record.rounds[0].alignments[17].hsps[0].bits, 128)
02220         self.assertAlmostEqual(record.rounds[0].alignments[17].hsps[0].expect, 9e-30)
02221         self.assertEqual(len(record.rounds[0].alignments[17].hsps), 1)
02222         self.assertEqual(record.rounds[0].alignments[18].hsps[0].score, 313)
02223         self.assertAlmostEqual(record.rounds[0].alignments[18].hsps[0].bits, 126)
02224         self.assertAlmostEqual(record.rounds[0].alignments[18].hsps[0].expect, 4e-29)
02225         self.assertEqual(len(record.rounds[0].alignments[18].hsps), 1)
02226         self.assertEqual(record.rounds[0].alignments[19].hsps[0].score, 311)
02227         self.assertAlmostEqual(record.rounds[0].alignments[19].hsps[0].bits, 125)
02228         self.assertAlmostEqual(record.rounds[0].alignments[19].hsps[0].expect, 6e-29)
02229         self.assertEqual(len(record.rounds[0].alignments[19].hsps), 1)
02230         self.assertEqual(record.rounds[0].alignments[20].hsps[0].score, 311)
02231         self.assertAlmostEqual(record.rounds[0].alignments[20].hsps[0].bits, 125)
02232         self.assertAlmostEqual(record.rounds[0].alignments[20].hsps[0].expect, 6e-29)
02233         self.assertEqual(len(record.rounds[0].alignments[20].hsps), 1)
02234         self.assertEqual(record.rounds[0].alignments[21].hsps[0].score, 306)
02235         self.assertAlmostEqual(record.rounds[0].alignments[21].hsps[0].bits, 123)
02236         self.assertAlmostEqual(record.rounds[0].alignments[21].hsps[0].expect, 2e-28)
02237         self.assertEqual(len(record.rounds[0].alignments[21].hsps), 1)
02238         self.assertEqual(record.rounds[0].alignments[22].hsps[0].score, 304)
02239         self.assertAlmostEqual(record.rounds[0].alignments[22].hsps[0].bits, 122)
02240         self.assertAlmostEqual(record.rounds[0].alignments[22].hsps[0].expect, 4e-28)
02241         self.assertEqual(len(record.rounds[0].alignments[22].hsps), 1)
02242         self.assertEqual(record.rounds[0].alignments[23].hsps[0].score, 263)
02243         self.assertAlmostEqual(record.rounds[0].alignments[23].hsps[0].bits, 106)
02244         self.assertAlmostEqual(record.rounds[0].alignments[23].hsps[0].expect, 3e-23)
02245         self.assertEqual(len(record.rounds[0].alignments[23].hsps), 1)
02246         self.assertEqual(record.rounds[0].alignments[24].hsps[0].score, 78)
02247         self.assertAlmostEqual(record.rounds[0].alignments[24].hsps[0].bits, 34.8)
02248         self.assertAlmostEqual(record.rounds[0].alignments[24].hsps[0].expect, 0.13)
02249         self.assertEqual(len(record.rounds[0].alignments[24].hsps), 1)
02250         self.assertEqual(record.rounds[0].alignments[25].hsps[0].score, 70)
02251         self.assertAlmostEqual(record.rounds[0].alignments[25].hsps[0].bits, 31.7)
02252         self.assertAlmostEqual(record.rounds[0].alignments[25].hsps[0].expect, 1.1)
02253         self.assertEqual(len(record.rounds[0].alignments[25].hsps), 1)
02254         self.assertEqual(record.rounds[0].alignments[26].hsps[0].score, 66)
02255         self.assertAlmostEqual(record.rounds[0].alignments[26].hsps[0].bits, 30.1)
02256         self.assertAlmostEqual(record.rounds[0].alignments[26].hsps[0].expect, 3.3)
02257         self.assertEqual(len(record.rounds[0].alignments[26].hsps), 1)
02258         self.assertEqual(record.rounds[0].alignments[27].hsps[0].score, 64)
02259         self.assertAlmostEqual(record.rounds[0].alignments[27].hsps[0].bits, 29.3)
02260         self.assertAlmostEqual(record.rounds[0].alignments[27].hsps[0].expect, 5.6)
02261         self.assertEqual(len(record.rounds[0].alignments[27].hsps), 1)
02262         self.assertEqual(record.rounds[0].alignments[28].hsps[0].score, 62)
02263         self.assertAlmostEqual(record.rounds[0].alignments[28].hsps[0].bits, 28.6)
02264         self.assertAlmostEqual(record.rounds[0].alignments[28].hsps[0].expect, 9.7)
02265         self.assertEqual(len(record.rounds[0].alignments[28].hsps), 1)
02266         self.assertEqual(record.rounds[0].alignments[29].hsps[0].score, 62)
02267         self.assertAlmostEqual(record.rounds[0].alignments[29].hsps[0].bits, 28.6)
02268         self.assertAlmostEqual(record.rounds[0].alignments[29].hsps[0].expect, 9.7)
02269         self.assertEqual(record.rounds[1].alignments[0].hsps[0].score, 820)
02270         self.assertAlmostEqual(record.rounds[1].alignments[0].hsps[0].bits, 323)
02271         self.assertAlmostEqual(record.rounds[1].alignments[0].hsps[0].expect, 1e-88)
02272         self.assertEqual(len(record.rounds[1].alignments[0].hsps), 1)
02273         self.assertEqual(record.rounds[1].alignments[1].hsps[0].score, 817)
02274         self.assertAlmostEqual(record.rounds[1].alignments[1].hsps[0].bits, 322)
02275         self.assertAlmostEqual(record.rounds[1].alignments[1].hsps[0].expect, 3e-88)
02276         self.assertEqual(len(record.rounds[1].alignments[1].hsps), 1)
02277         self.assertEqual(record.rounds[1].alignments[2].hsps[0].score, 808)
02278         self.assertAlmostEqual(record.rounds[1].alignments[2].hsps[0].bits, 318)
02279         self.assertAlmostEqual(record.rounds[1].alignments[2].hsps[0].expect, 4e-87)
02280         self.assertEqual(len(record.rounds[1].alignments[2].hsps), 1)
02281         self.assertEqual(record.rounds[1].alignments[3].hsps[0].score, 798)
02282         self.assertAlmostEqual(record.rounds[1].alignments[3].hsps[0].bits, 315)
02283         self.assertAlmostEqual(record.rounds[1].alignments[3].hsps[0].expect, 5e-86)
02284         self.assertEqual(len(record.rounds[1].alignments[3].hsps), 1)
02285         self.assertEqual(record.rounds[1].alignments[4].hsps[0].score, 795)
02286         self.assertAlmostEqual(record.rounds[1].alignments[4].hsps[0].bits, 313)
02287         self.assertAlmostEqual(record.rounds[1].alignments[4].hsps[0].expect, 1e-85)
02288         self.assertEqual(len(record.rounds[1].alignments[4].hsps), 1)
02289         self.assertEqual(record.rounds[1].alignments[5].hsps[0].score, 793)
02290         self.assertAlmostEqual(record.rounds[1].alignments[5].hsps[0].bits, 313)
02291         self.assertAlmostEqual(record.rounds[1].alignments[5].hsps[0].expect, 2e-85)
02292         self.assertEqual(len(record.rounds[1].alignments[5].hsps), 1)
02293         self.assertEqual(record.rounds[1].alignments[6].hsps[0].score, 776)
02294         self.assertAlmostEqual(record.rounds[1].alignments[6].hsps[0].bits, 306)
02295         self.assertAlmostEqual(record.rounds[1].alignments[6].hsps[0].expect, 2e-83)
02296         self.assertEqual(len(record.rounds[1].alignments[6].hsps), 1)
02297         self.assertEqual(record.rounds[1].alignments[7].hsps[0].score, 772)
02298         self.assertAlmostEqual(record.rounds[1].alignments[7].hsps[0].bits, 304)
02299         self.assertAlmostEqual(record.rounds[1].alignments[7].hsps[0].expect, 6e-83)
02300         self.assertEqual(len(record.rounds[1].alignments[7].hsps), 1)
02301         self.assertEqual(record.rounds[1].alignments[8].hsps[0].score, 771)
02302         self.assertAlmostEqual(record.rounds[1].alignments[8].hsps[0].bits, 304)
02303         self.assertAlmostEqual(record.rounds[1].alignments[8].hsps[0].expect, 8e-83)
02304         self.assertEqual(len(record.rounds[1].alignments[8].hsps), 1)
02305         self.assertEqual(record.rounds[1].alignments[9].hsps[0].score, 770)
02306         self.assertAlmostEqual(record.rounds[1].alignments[9].hsps[0].bits, 304)
02307         self.assertAlmostEqual(record.rounds[1].alignments[9].hsps[0].expect, 1e-82)
02308         self.assertEqual(len(record.rounds[1].alignments[9].hsps), 1)
02309         self.assertEqual(record.rounds[1].alignments[10].hsps[0].score, 767)
02310         self.assertAlmostEqual(record.rounds[1].alignments[10].hsps[0].bits, 303)
02311         self.assertAlmostEqual(record.rounds[1].alignments[10].hsps[0].expect, 2e-82)
02312         self.assertEqual(len(record.rounds[1].alignments[10].hsps), 1)
02313         self.assertEqual(record.rounds[1].alignments[11].hsps[0].score, 765)
02314         self.assertAlmostEqual(record.rounds[1].alignments[11].hsps[0].bits, 302)
02315         self.assertAlmostEqual(record.rounds[1].alignments[11].hsps[0].expect, 4e-82)
02316         self.assertEqual(len(record.rounds[1].alignments[11].hsps), 1)
02317         self.assertEqual(record.rounds[1].alignments[12].hsps[0].score, 762)
02318         self.assertAlmostEqual(record.rounds[1].alignments[12].hsps[0].bits, 301)
02319         self.assertAlmostEqual(record.rounds[1].alignments[12].hsps[0].expect, 9e-82)
02320         self.assertEqual(len(record.rounds[1].alignments[12].hsps), 1)
02321         self.assertEqual(record.rounds[1].alignments[13].hsps[0].score, 759)
02322         self.assertAlmostEqual(record.rounds[1].alignments[13].hsps[0].bits, 299)
02323         self.assertAlmostEqual(record.rounds[1].alignments[13].hsps[0].expect, 2e-81)
02324         self.assertEqual(len(record.rounds[1].alignments[13].hsps), 1)
02325         self.assertEqual(record.rounds[1].alignments[14].hsps[0].score, 756)
02326         self.assertAlmostEqual(record.rounds[1].alignments[14].hsps[0].bits, 298)
02327         self.assertAlmostEqual(record.rounds[1].alignments[14].hsps[0].expect, 5e-81)
02328         self.assertEqual(len(record.rounds[1].alignments[14].hsps), 1)
02329         self.assertEqual(record.rounds[1].alignments[15].hsps[0].score, 741)
02330         self.assertAlmostEqual(record.rounds[1].alignments[15].hsps[0].bits, 292)
02331         self.assertAlmostEqual(record.rounds[1].alignments[15].hsps[0].expect, 3e-79)
02332         self.assertEqual(len(record.rounds[1].alignments[15].hsps), 1)
02333         self.assertEqual(record.rounds[1].alignments[16].hsps[0].score, 734)
02334         self.assertAlmostEqual(record.rounds[1].alignments[16].hsps[0].bits, 290)
02335         self.assertAlmostEqual(record.rounds[1].alignments[16].hsps[0].expect, 2e-78)
02336         self.assertEqual(len(record.rounds[1].alignments[16].hsps), 1)
02337         self.assertEqual(record.rounds[1].alignments[17].hsps[0].score, 734)
02338         self.assertAlmostEqual(record.rounds[1].alignments[17].hsps[0].bits, 290)
02339         self.assertAlmostEqual(record.rounds[1].alignments[17].hsps[0].expect, 2e-78)
02340         self.assertEqual(len(record.rounds[1].alignments[17].hsps), 1)
02341         self.assertEqual(record.rounds[1].alignments[18].hsps[0].score, 726)
02342         self.assertAlmostEqual(record.rounds[1].alignments[18].hsps[0].bits, 287)
02343         self.assertAlmostEqual(record.rounds[1].alignments[18].hsps[0].expect, 1e-77)
02344         self.assertEqual(len(record.rounds[1].alignments[18].hsps), 1)
02345         self.assertEqual(record.rounds[1].alignments[19].hsps[0].score, 716)
02346         self.assertAlmostEqual(record.rounds[1].alignments[19].hsps[0].bits, 283)
02347         self.assertAlmostEqual(record.rounds[1].alignments[19].hsps[0].expect, 2e-76)
02348         self.assertEqual(len(record.rounds[1].alignments[19].hsps), 1)
02349         self.assertEqual(record.rounds[1].alignments[20].hsps[0].score, 695)
02350         self.assertAlmostEqual(record.rounds[1].alignments[20].hsps[0].bits, 274)
02351         self.assertAlmostEqual(record.rounds[1].alignments[20].hsps[0].expect, 6e-74)
02352         self.assertEqual(len(record.rounds[1].alignments[20].hsps), 1)
02353         self.assertEqual(record.rounds[1].alignments[21].hsps[0].score, 685)
02354         self.assertAlmostEqual(record.rounds[1].alignments[21].hsps[0].bits, 271)
02355         self.assertAlmostEqual(record.rounds[1].alignments[21].hsps[0].expect, 1e-72)
02356         self.assertEqual(len(record.rounds[1].alignments[21].hsps), 1)
02357         self.assertEqual(record.rounds[1].alignments[22].hsps[0].score, 680)
02358         self.assertAlmostEqual(record.rounds[1].alignments[22].hsps[0].bits, 269)
02359         self.assertAlmostEqual(record.rounds[1].alignments[22].hsps[0].expect, 4e-72)
02360         self.assertEqual(len(record.rounds[1].alignments[22].hsps), 1)
02361         self.assertEqual(record.rounds[1].alignments[23].hsps[0].score, 662)
02362         self.assertAlmostEqual(record.rounds[1].alignments[23].hsps[0].bits, 262)
02363         self.assertAlmostEqual(record.rounds[1].alignments[23].hsps[0].expect, 5e-70)
02364         self.assertEqual(len(record.rounds[1].alignments[23].hsps), 1)
02365         self.assertEqual(record.rounds[0].alignments[0].hsps[0].identities, (200, 200))
02366         self.assertEqual(record.rounds[0].alignments[0].hsps[0].positives, (200, 200))
02367         self.assertEqual(record.rounds[0].alignments[1].hsps[0].identities, (99, 198))
02368         self.assertEqual(record.rounds[0].alignments[1].hsps[0].positives, (135, 198))
02369         self.assertEqual(record.rounds[0].alignments[1].hsps[0].gaps, (4, 198))
02370         self.assertEqual(record.rounds[0].alignments[2].hsps[0].identities, (96, 199))
02371         self.assertEqual(record.rounds[0].alignments[2].hsps[0].positives, (136, 199))
02372         self.assertEqual(record.rounds[0].alignments[2].hsps[0].gaps, (4, 199))
02373         self.assertEqual(record.rounds[0].alignments[3].hsps[0].identities, (91, 194))
02374         self.assertEqual(record.rounds[0].alignments[3].hsps[0].positives, (126, 194))
02375         self.assertEqual(record.rounds[0].alignments[3].hsps[0].gaps, (4, 194))
02376         self.assertEqual(record.rounds[0].alignments[4].hsps[0].identities, (93, 194))
02377         self.assertEqual(record.rounds[0].alignments[4].hsps[0].positives, (128, 194))
02378         self.assertEqual(record.rounds[0].alignments[4].hsps[0].gaps, (4, 194))
02379         self.assertEqual(record.rounds[0].alignments[5].hsps[0].identities, (89, 200))
02380         self.assertEqual(record.rounds[0].alignments[5].hsps[0].positives, (124, 200))
02381         self.assertEqual(record.rounds[0].alignments[5].hsps[0].gaps, (3, 200))
02382         self.assertEqual(record.rounds[0].alignments[6].hsps[0].identities, (91, 198))
02383         self.assertEqual(record.rounds[0].alignments[6].hsps[0].positives, (131, 198))
02384         self.assertEqual(record.rounds[0].alignments[6].hsps[0].gaps, (4, 198))
02385         self.assertEqual(record.rounds[0].alignments[7].hsps[0].identities, (91, 198))
02386         self.assertEqual(record.rounds[0].alignments[7].hsps[0].positives, (130, 198))
02387         self.assertEqual(record.rounds[0].alignments[7].hsps[0].gaps, (9, 198))
02388         self.assertEqual(record.rounds[0].alignments[8].hsps[0].identities, (88, 198))
02389         self.assertEqual(record.rounds[0].alignments[8].hsps[0].positives, (129, 198))
02390         self.assertEqual(record.rounds[0].alignments[8].hsps[0].gaps, (4, 198))
02391         self.assertEqual(record.rounds[0].alignments[9].hsps[0].identities, (89, 198))
02392         self.assertEqual(record.rounds[0].alignments[9].hsps[0].positives, (127, 198))
02393         self.assertEqual(record.rounds[0].alignments[9].hsps[0].gaps, (9, 198))
02394         self.assertEqual(record.rounds[0].alignments[10].hsps[0].identities, (92, 207))
02395         self.assertEqual(record.rounds[0].alignments[10].hsps[0].positives, (125, 207))
02396         self.assertEqual(record.rounds[0].alignments[10].hsps[0].gaps, (14, 207))
02397         self.assertEqual(record.rounds[0].alignments[11].hsps[0].identities, (89, 198))
02398         self.assertEqual(record.rounds[0].alignments[11].hsps[0].positives, (129, 198))
02399         self.assertEqual(record.rounds[0].alignments[11].hsps[0].gaps, (10, 198))
02400         self.assertEqual(record.rounds[0].alignments[12].hsps[0].identities, (81, 198))
02401         self.assertEqual(record.rounds[0].alignments[12].hsps[0].positives, (122, 198))
02402         self.assertEqual(record.rounds[0].alignments[12].hsps[0].gaps, (8, 198))
02403         self.assertEqual(record.rounds[0].alignments[13].hsps[0].identities, (83, 203))
02404         self.assertEqual(record.rounds[0].alignments[13].hsps[0].positives, (120, 203))
02405         self.assertEqual(record.rounds[0].alignments[13].hsps[0].gaps, (11, 203))
02406         self.assertEqual(record.rounds[0].alignments[14].hsps[0].identities, (88, 201))
02407         self.assertEqual(record.rounds[0].alignments[14].hsps[0].positives, (128, 201))
02408         self.assertEqual(record.rounds[0].alignments[14].hsps[0].gaps, (9, 201))
02409         self.assertEqual(record.rounds[0].alignments[15].hsps[0].identities, (86, 198))
02410         self.assertEqual(record.rounds[0].alignments[15].hsps[0].positives, (120, 198))
02411         self.assertEqual(record.rounds[0].alignments[15].hsps[0].gaps, (6, 198))
02412         self.assertEqual(record.rounds[0].alignments[16].hsps[0].identities, (84, 221))
02413         self.assertEqual(record.rounds[0].alignments[16].hsps[0].positives, (114, 221))
02414         self.assertEqual(record.rounds[0].alignments[16].hsps[0].gaps, (29, 221))
02415         self.assertEqual(record.rounds[0].alignments[17].hsps[0].identities, (81, 227))
02416         self.assertEqual(record.rounds[0].alignments[17].hsps[0].positives, (119, 227))
02417         self.assertEqual(record.rounds[0].alignments[17].hsps[0].gaps, (33, 227))
02418         self.assertEqual(record.rounds[0].alignments[18].hsps[0].identities, (80, 196))
02419         self.assertEqual(record.rounds[0].alignments[18].hsps[0].positives, (107, 196))
02420         self.assertEqual(record.rounds[0].alignments[18].hsps[0].gaps, (9, 196))
02421         self.assertEqual(record.rounds[0].alignments[19].hsps[0].identities, (81, 222))
02422         self.assertEqual(record.rounds[0].alignments[19].hsps[0].positives, (119, 222))
02423         self.assertEqual(record.rounds[0].alignments[19].hsps[0].gaps, (30, 222))
02424         self.assertEqual(record.rounds[0].alignments[20].hsps[0].identities, (84, 223))
02425         self.assertEqual(record.rounds[0].alignments[20].hsps[0].positives, (116, 223))
02426         self.assertEqual(record.rounds[0].alignments[20].hsps[0].gaps, (31, 223))
02427         self.assertEqual(record.rounds[0].alignments[21].hsps[0].identities, (78, 215))
02428         self.assertEqual(record.rounds[0].alignments[21].hsps[0].positives, (116, 215))
02429         self.assertEqual(record.rounds[0].alignments[21].hsps[0].gaps, (24, 215))
02430         self.assertEqual(record.rounds[0].alignments[22].hsps[0].identities, (79, 218))
02431         self.assertEqual(record.rounds[0].alignments[22].hsps[0].positives, (114, 218))
02432         self.assertEqual(record.rounds[0].alignments[22].hsps[0].gaps, (30, 218))
02433         self.assertEqual(record.rounds[0].alignments[23].hsps[0].identities, (68, 202))
02434         self.assertEqual(record.rounds[0].alignments[23].hsps[0].positives, (102, 202))
02435         self.assertEqual(record.rounds[0].alignments[23].hsps[0].gaps, (28, 202))
02436         self.assertEqual(record.rounds[0].alignments[24].hsps[0].identities, (34, 134))
02437         self.assertEqual(record.rounds[0].alignments[24].hsps[0].positives, (60, 134))
02438         self.assertEqual(record.rounds[0].alignments[24].hsps[0].gaps, (11, 134))
02439         self.assertEqual(record.rounds[0].alignments[25].hsps[0].identities, (16, 45))
02440         self.assertEqual(record.rounds[0].alignments[25].hsps[0].positives, (21, 45))
02441         self.assertEqual(record.rounds[0].alignments[25].hsps[0].gaps, (3, 45))
02442         self.assertEqual(record.rounds[0].alignments[26].hsps[0].identities, (17, 48))
02443         self.assertEqual(record.rounds[0].alignments[26].hsps[0].positives, (24, 48))
02444         self.assertEqual(record.rounds[0].alignments[26].hsps[0].gaps, (3, 48))
02445         self.assertEqual(record.rounds[0].alignments[27].hsps[0].identities, (25, 70))
02446         self.assertEqual(record.rounds[0].alignments[27].hsps[0].positives, (32, 70))
02447         self.assertEqual(record.rounds[0].alignments[27].hsps[0].gaps, (5, 70))
02448         self.assertEqual(record.rounds[0].alignments[28].hsps[0].identities, (16, 48))
02449         self.assertEqual(record.rounds[0].alignments[28].hsps[0].positives, (24, 48))
02450         self.assertEqual(record.rounds[0].alignments[28].hsps[0].gaps, (3, 48))
02451         self.assertEqual(record.rounds[0].alignments[29].hsps[0].identities, (20, 65))
02452         self.assertEqual(record.rounds[0].alignments[29].hsps[0].positives, (31, 65))
02453         self.assertEqual(record.rounds[0].alignments[29].hsps[0].gaps, (7, 65))
02454         self.assertEqual(record.rounds[1].alignments[0].hsps[0].identities, (96, 199))
02455         self.assertEqual(record.rounds[1].alignments[0].hsps[0].positives, (136, 199))
02456         self.assertEqual(record.rounds[1].alignments[0].hsps[0].gaps, (4, 199))
02457         self.assertEqual(record.rounds[1].alignments[1].hsps[0].identities, (99, 198))
02458         self.assertEqual(record.rounds[1].alignments[1].hsps[0].positives, (135, 198))
02459         self.assertEqual(record.rounds[1].alignments[1].hsps[0].gaps, (4, 198))
02460         self.assertEqual(record.rounds[1].alignments[2].hsps[0].identities, (200, 200))
02461         self.assertEqual(record.rounds[1].alignments[2].hsps[0].positives, (200, 200))
02462         self.assertEqual(record.rounds[1].alignments[3].hsps[0].identities, (88, 198))
02463         self.assertEqual(record.rounds[1].alignments[3].hsps[0].positives, (129, 198))
02464         self.assertEqual(record.rounds[1].alignments[3].hsps[0].gaps, (4, 198))
02465         self.assertEqual(record.rounds[1].alignments[4].hsps[0].identities, (91, 198))
02466         self.assertEqual(record.rounds[1].alignments[4].hsps[0].positives, (131, 198))
02467         self.assertEqual(record.rounds[1].alignments[4].hsps[0].gaps, (4, 198))
02468         self.assertEqual(record.rounds[1].alignments[5].hsps[0].identities, (93, 196))
02469         self.assertEqual(record.rounds[1].alignments[5].hsps[0].positives, (128, 196))
02470         self.assertEqual(record.rounds[1].alignments[5].hsps[0].gaps, (4, 196))
02471         self.assertEqual(record.rounds[1].alignments[6].hsps[0].identities, (89, 200))
02472         self.assertEqual(record.rounds[1].alignments[6].hsps[0].positives, (124, 200))
02473         self.assertEqual(record.rounds[1].alignments[6].hsps[0].gaps, (3, 200))
02474         self.assertEqual(record.rounds[1].alignments[7].hsps[0].identities, (78, 220))
02475         self.assertEqual(record.rounds[1].alignments[7].hsps[0].positives, (115, 220))
02476         self.assertEqual(record.rounds[1].alignments[7].hsps[0].gaps, (30, 220))
02477         self.assertEqual(record.rounds[1].alignments[8].hsps[0].identities, (81, 227))
02478         self.assertEqual(record.rounds[1].alignments[8].hsps[0].positives, (119, 227))
02479         self.assertEqual(record.rounds[1].alignments[8].hsps[0].gaps, (33, 227))
02480         self.assertEqual(record.rounds[1].alignments[9].hsps[0].identities, (79, 222))
02481         self.assertEqual(record.rounds[1].alignments[9].hsps[0].positives, (118, 222))
02482         self.assertEqual(record.rounds[1].alignments[9].hsps[0].gaps, (30, 222))
02483         self.assertEqual(record.rounds[1].alignments[10].hsps[0].identities, (76, 214))
02484         self.assertEqual(record.rounds[1].alignments[10].hsps[0].positives, (113, 214))
02485         self.assertEqual(record.rounds[1].alignments[10].hsps[0].gaps, (24, 214))
02486         self.assertEqual(record.rounds[1].alignments[11].hsps[0].identities, (91, 198))
02487         self.assertEqual(record.rounds[1].alignments[11].hsps[0].positives, (130, 198))
02488         self.assertEqual(record.rounds[1].alignments[11].hsps[0].gaps, (9, 198))
02489         self.assertEqual(record.rounds[1].alignments[12].hsps[0].identities, (91, 196))
02490         self.assertEqual(record.rounds[1].alignments[12].hsps[0].positives, (127, 196))
02491         self.assertEqual(record.rounds[1].alignments[12].hsps[0].gaps, (4, 196))
02492         self.assertEqual(record.rounds[1].alignments[13].hsps[0].identities, (83, 203))
02493         self.assertEqual(record.rounds[1].alignments[13].hsps[0].positives, (120, 203))
02494         self.assertEqual(record.rounds[1].alignments[13].hsps[0].gaps, (11, 203))
02495         self.assertEqual(record.rounds[1].alignments[14].hsps[0].identities, (82, 223))
02496         self.assertEqual(record.rounds[1].alignments[14].hsps[0].positives, (115, 223))
02497         self.assertEqual(record.rounds[1].alignments[14].hsps[0].gaps, (31, 223))
02498         self.assertEqual(record.rounds[1].alignments[15].hsps[0].identities, (89, 198))
02499         self.assertEqual(record.rounds[1].alignments[15].hsps[0].positives, (127, 198))
02500         self.assertEqual(record.rounds[1].alignments[15].hsps[0].gaps, (9, 198))
02501         self.assertEqual(record.rounds[1].alignments[16].hsps[0].identities, (83, 221))
02502         self.assertEqual(record.rounds[1].alignments[16].hsps[0].positives, (114, 221))
02503         self.assertEqual(record.rounds[1].alignments[16].hsps[0].gaps, (29, 221))
02504         self.assertEqual(record.rounds[1].alignments[17].hsps[0].identities, (86, 199))
02505         self.assertEqual(record.rounds[1].alignments[17].hsps[0].positives, (121, 199))
02506         self.assertEqual(record.rounds[1].alignments[17].hsps[0].gaps, (8, 199))
02507         self.assertEqual(record.rounds[1].alignments[18].hsps[0].identities, (89, 198))
02508         self.assertEqual(record.rounds[1].alignments[18].hsps[0].positives, (129, 198))
02509         self.assertEqual(record.rounds[1].alignments[18].hsps[0].gaps, (10, 198))
02510         self.assertEqual(record.rounds[1].alignments[19].hsps[0].identities, (92, 207))
02511         self.assertEqual(record.rounds[1].alignments[19].hsps[0].positives, (124, 207))
02512         self.assertEqual(record.rounds[1].alignments[19].hsps[0].gaps, (14, 207))
02513         self.assertEqual(record.rounds[1].alignments[20].hsps[0].identities, (81, 198))
02514         self.assertEqual(record.rounds[1].alignments[20].hsps[0].positives, (122, 198))
02515         self.assertEqual(record.rounds[1].alignments[20].hsps[0].gaps, (8, 198))
02516         self.assertEqual(record.rounds[1].alignments[21].hsps[0].identities, (79, 196))
02517         self.assertEqual(record.rounds[1].alignments[21].hsps[0].positives, (106, 196))
02518         self.assertEqual(record.rounds[1].alignments[21].hsps[0].gaps, (9, 196))
02519         self.assertEqual(record.rounds[1].alignments[22].hsps[0].identities, (68, 202))
02520         self.assertEqual(record.rounds[1].alignments[22].hsps[0].positives, (102, 202))
02521         self.assertEqual(record.rounds[1].alignments[22].hsps[0].gaps, (28, 202))
02522         self.assertEqual(record.rounds[1].alignments[23].hsps[0].identities, (83, 200))
02523         self.assertEqual(record.rounds[1].alignments[23].hsps[0].positives, (124, 200))
02524         self.assertEqual(record.rounds[1].alignments[23].hsps[0].gaps, (7, 200))

Here is the caller graph for this function:

Definition at line 2525 of file test_NCBITextParser.py.

02525 
02526     def _check_bt009_hsps_details(self, record):
02527         self.assertEqual(record.rounds[0].alignments[0].hsps[0].query, "MTRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02528         self.assertEqual(record.rounds[0].alignments[0].hsps[0].match, "MTRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02529         self.assertEqual(record.rounds[0].alignments[0].hsps[0].sbjct, "MTRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02530         self.assertEqual(record.rounds[0].alignments[0].hsps[0].query_start, 1)
02531         self.assertEqual(record.rounds[0].alignments[0].hsps[0].query_end, 200)
02532         self.assertEqual(record.rounds[0].alignments[0].hsps[0].sbjct_start, 1)
02533         self.assertEqual(record.rounds[0].alignments[0].hsps[0].sbjct_end, 200)
02534         self.assertEqual(record.rounds[0].alignments[1].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02535         self.assertEqual(record.rounds[0].alignments[1].hsps[0].match, "RI  + R TKET + + INLDGTG AD S+GI FLDHML  L  H  FD+ +   GD   V +D HH  ED+A+A+G  + + LG + GI R+G FT P+DEAL+   LD+SGRPYL ++ ++   Q++G YDT++ E FF++L   +G+TLH+ +  G+N+HHIIE  FK+ ARAL+QA   D  + G IPSSKGVL")
02536         self.assertEqual(record.rounds[0].alignments[1].hsps[0].sbjct, "RIGEVKRVTKETNVSVKINLDGTGVADSSSGIPFLDHMLDQLASHGLFDVHVRATGD---VHIDDHHTNEDIALAIGTALLKALGERKGINRFGDFTAPLDEALIHVSLDLSGRPYLGYNLEIP-TQRVGTYDTQLVEHFFQSLVNTSGMTLHIRQLAGENSHHIIEATFKAFARALRQATETDPRRGGTIPSSKGVL")
02537         self.assertEqual(record.rounds[0].alignments[1].hsps[0].query_start, 3)
02538         self.assertEqual(record.rounds[0].alignments[1].hsps[0].query_end, 200)
02539         self.assertEqual(record.rounds[0].alignments[1].hsps[0].sbjct_start, 74)
02540         self.assertEqual(record.rounds[0].alignments[1].hsps[0].sbjct_end, 267)
02541         self.assertEqual(record.rounds[0].alignments[2].hsps[0].query, "TRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02542         self.assertEqual(record.rounds[0].alignments[2].hsps[0].match, "TR+  + R TKET + + INLDG+G AD STGI FLDHML  L  H  FD+ +   GD   V +D HH  EDVA+A+G  + + LG++ GI R+G F+ P+DEAL+   LD+SGRP+L ++ D+   Q++G YDT++ E F +++   +G+TLH+ +  G+N+HHIIE  FK+ ARAL+QA   D  + G +PSSKGVL")
02543         self.assertEqual(record.rounds[0].alignments[2].hsps[0].sbjct, "TRVGEVKRVTKETNVSVKINLDGSGVADSSTGIPFLDHMLDQLASHGLFDVHVKATGD---VHIDDHHTNEDVALAIGTALLQALGDRKGINRFGDFSAPLDEALIHVSLDLSGRPHLSYNLDIP-TQRVGTYDTQVVEHFLQSIVNTSGMTLHIRQLAGRNSHHIIEATFKAFARALRQATEYDPRRRGSVPSSKGVL")
02544         self.assertEqual(record.rounds[0].alignments[2].hsps[0].query_start, 2)
02545         self.assertEqual(record.rounds[0].alignments[2].hsps[0].query_end, 200)
02546         self.assertEqual(record.rounds[0].alignments[2].hsps[0].sbjct_start, 84)
02547         self.assertEqual(record.rounds[0].alignments[2].hsps[0].sbjct_end, 278)
02548         self.assertEqual(record.rounds[0].alignments[3].hsps[0].query, "ITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02549         self.assertEqual(record.rounds[0].alignments[3].hsps[0].match, "I RNT ET+I +++NLDGTG  D+ TG+GFLDHML  L+ HS  DL +   GD   V +D HH  E   IA+G+ +++ +G++ GI+RYG   +PMDE L    LD S RPYL++    S   K+G  DTE+  E+F+A A  AG+TLH+   YG+N HHI+E  +K+ ARAL+  + ID  K   +PS+KG L")
02550         self.assertEqual(record.rounds[0].alignments[3].hsps[0].sbjct, "IERNTTETRIRVAVNLDGTGVYDVKTGVGFLDHMLEQLSRHSLMDLSVAAEGD---VHIDAHHTTEHSGIAIGQAVAKAVGDRKGIQRYGHAYVPMDETLTRVALDFSNRPYLIWKVSFS-RDKIGDMDTELFREWFQAFAMAAGVTLHVECLYGENNHHIVESCYKALARALRAGIEIDPRKRDAVPSTKGTL")
02551         self.assertEqual(record.rounds[0].alignments[3].hsps[0].query_start, 7)
02552         self.assertEqual(record.rounds[0].alignments[3].hsps[0].query_end, 200)
02553         self.assertEqual(record.rounds[0].alignments[3].hsps[0].sbjct_start, 14)
02554         self.assertEqual(record.rounds[0].alignments[3].hsps[0].sbjct_end, 203)
02555         self.assertEqual(record.rounds[0].alignments[4].hsps[0].query, "ITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02556         self.assertEqual(record.rounds[0].alignments[4].hsps[0].match, "+ R TKET + + INLDGTG A+ STGI FLDHML  L  H  FD+ +   GD     +D HH  ED+A+A+G  + + LG++ GI R+G FT P+DEA V   LD+SGRP+L     +   +++G YDT++ E FF++L   +G+TLH+ +  G N+HHIIE  FK+ ARAL+QA   D  + G +PSSKGVL")
02557         self.assertEqual(record.rounds[0].alignments[4].hsps[0].sbjct, "VKRVTKETNVHVKINLDGTGVANSSTGIPFLDHMLDQLASHGLFDVYVKATGDTH---IDDHHSNEDIALAIGTALLQALGDRKGINRFGHFTAPLDEAAVEVILDLSGRPHLSCGLSIP-TERVGTYDTQLVEHFFQSLVNTSGMTLHIRQLAGNNSHHIIEATFKAFARALRQATEYDLRRQGTMPSSKGVL")
02558         self.assertEqual(record.rounds[0].alignments[4].hsps[0].query_start, 7)
02559         self.assertEqual(record.rounds[0].alignments[4].hsps[0].query_end, 200)
02560         self.assertEqual(record.rounds[0].alignments[4].hsps[0].sbjct_start, 3)
02561         self.assertEqual(record.rounds[0].alignments[4].hsps[0].sbjct_end, 192)
02562         self.assertEqual(record.rounds[0].alignments[5].hsps[0].query, "MTRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02563         self.assertEqual(record.rounds[0].alignments[5].hsps[0].match, "M+R+  + R TKET + + I+LDGTG+ DI+TG+GF DHML  L  H  FDL +   GD   + +D HH IED A+ALG    + LG+K+GI R+G+ T+P+DE+L    +D+SGRPYLV     +    +G YD  MT     +    A + LH++  YG+N HHI+E  FK+ ARAL+ A   D    G +PS+KG L")
02564         self.assertEqual(record.rounds[0].alignments[5].hsps[0].sbjct, "MSRVGRVERTTKETSVLVEIDLDGTGKTDIATGVGFYDHMLDQLGRHGLFDLTVKTDGD---LHIDSHHTIEDTALALGAAFRQALGDKVGIYRFGNCTVPLDESLAQVTVDLSGRPYLVHTEPENMAPMIGEYDVTMTRHILESFVAQAQVALHVHVPYGRNAHHIVECQFKALARALRYASERDPRAAGILPSTKGAL")
02565         self.assertEqual(record.rounds[0].alignments[5].hsps[0].query_start, 1)
02566         self.assertEqual(record.rounds[0].alignments[5].hsps[0].query_end, 200)
02567         self.assertEqual(record.rounds[0].alignments[5].hsps[0].sbjct_start, 1)
02568         self.assertEqual(record.rounds[0].alignments[5].hsps[0].sbjct_end, 197)
02569         self.assertEqual(record.rounds[0].alignments[6].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02570         self.assertEqual(record.rounds[0].alignments[6].hsps[0].match, "RI+ + R T ET +++++NLDGTG    +TGI FLDHML  ++ H   DL +   GD E   +D HH  EDV I LG+ +++ LG++ GI R+G+F  P+DEALV   LD SGRP+L +   +   +++G YDT++  EFF AL  ++ +TLH+ +  G N+HHIIE  FK+ ARA + A+ +D  + G IPSSKGVL")
02571         self.assertEqual(record.rounds[0].alignments[6].hsps[0].sbjct, "RIASVHRITGETNVQVTVNLDGTGICKAATGIPFLDHMLHQISSHGLIDLDVQAKGDWE---IDDHHTNEDVGITLGQALAKALGDRKGIVRFGNFLAPLDEALVQVALDFSGRPHLSYGLQIP-TERVGTYDTQLVREFFVALVNHSQMTLHIRQLDGINSHHIIEATFKAFARAARMAIEVDPRRAGTIPSSKGVL")
02572         self.assertEqual(record.rounds[0].alignments[6].hsps[0].query_start, 3)
02573         self.assertEqual(record.rounds[0].alignments[6].hsps[0].query_end, 200)
02574         self.assertEqual(record.rounds[0].alignments[6].hsps[0].sbjct_start, 16)
02575         self.assertEqual(record.rounds[0].alignments[6].hsps[0].sbjct_end, 209)
02576         self.assertEqual(record.rounds[0].alignments[7].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02577         self.assertEqual(record.rounds[0].alignments[7].hsps[0].match, "R +H+ RNTKETQI++ + LD  G + I+TG+GF DHML  +  H  F ++I   GD   + +D HH +ED  +ALG+ +   LG+K GI R+G F +PMDE L  C LDISGRP+L + A+ +  Q++G   TEM E FFR+L++  G+TLHL    G+N HH +E +FK+  R L+QA+ ++      +PSSKGVL")
02578         self.assertEqual(record.rounds[0].alignments[7].hsps[0].sbjct, "RYAHVVRNTKETQIDVQVWLDREGGSKINTGVGFFDHMLDQIATHGGFRMEINVKGD---LYIDDHHTVEDTGLALGEALKIALGDKRGICRFG-FVLPMDECLARCALDISGRPHLEYKAEFT-YQRVGDLSTEMIEHFFRSLSYTMGVTLHLKTK-GKNDHHRVESLFKAFGRTLRQAIRVEGD---TLPSSKGVL")
02579         self.assertEqual(record.rounds[0].alignments[7].hsps[0].query_start, 3)
02580         self.assertEqual(record.rounds[0].alignments[7].hsps[0].query_end, 200)
02581         self.assertEqual(record.rounds[0].alignments[7].hsps[0].sbjct_start, 167)
02582         self.assertEqual(record.rounds[0].alignments[7].hsps[0].sbjct_end, 355)
02583         self.assertEqual(record.rounds[0].alignments[8].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02584         self.assertEqual(record.rounds[0].alignments[8].hsps[0].match, "R + + R TKET + +S+NL G+G   ++TG+ FLDHML  +  H   DL++   GD E   +D HH  EDV I LG+ ++E LG++ GI R+G F  P+DEALV   LD SGRP+L +   +   +++G YDT++  EFF A+  ++ +TLH+ +  G N+HHIIE  FK+ ARA++ A+ +D  +   IPSSKGVL")
02585         self.assertEqual(record.rounds[0].alignments[8].hsps[0].sbjct, "RAAAVHRVTKETDVRVSLNLMGSGLCHVATGVPFLDHMLHQIASHGLIDLEVNATGDIE---IDDHHTNEDVGITLGQALAEALGDRRGINRFGHFIAPLDEALVQVTLDFSGRPHLSYGLQIP-TERVGTYDTQLVREFFVAVVNHSQMTLHIRQLDGINSHHIIEATFKAFARAMRMAIEVDPRRADTIPSSKGVL")
02586         self.assertEqual(record.rounds[0].alignments[8].hsps[0].query_start, 3)
02587         self.assertEqual(record.rounds[0].alignments[8].hsps[0].query_end, 200)
02588         self.assertEqual(record.rounds[0].alignments[8].hsps[0].sbjct_start, 17)
02589         self.assertEqual(record.rounds[0].alignments[8].hsps[0].sbjct_end, 210)
02590         self.assertEqual(record.rounds[0].alignments[9].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02591         self.assertEqual(record.rounds[0].alignments[9].hsps[0].match, "R + + R TKET I++ + LD  G  +I TG+GF DHML  +  H  F + +   GD   + +D HH +ED A+ALG+ + + +G+K GI R+G F +PMDE    C LD+SGRP++ F+A      K+G + TE+TE FF++LAF+   TLHLN   G N HH IE +FK+  R L+QA+ I+ +   E+PSSKGVL")
02592         self.assertEqual(record.rounds[0].alignments[9].hsps[0].sbjct, "RFAEVIRQTKETDIKVQVWLDEAGVNEIKTGVGFFDHMLDQIATHGGFRMNVQCKGD---LWIDEHHTVEDTALALGQALKQAVGDKRGIARFG-FVLPMDECKAECALDLSGRPWIKFNACFK-RDKVGDFSTELTEHFFQSLAFSMLATLHLNV-TGNNDHHKIESLFKAFGRTLRQAIRIEGN---EMPSSKGVL")
02593         self.assertEqual(record.rounds[0].alignments[9].hsps[0].query_start, 3)
02594         self.assertEqual(record.rounds[0].alignments[9].hsps[0].query_end, 200)
02595         self.assertEqual(record.rounds[0].alignments[9].hsps[0].sbjct_start, 174)
02596         self.assertEqual(record.rounds[0].alignments[9].hsps[0].sbjct_end, 362)
02597         self.assertEqual(record.rounds[0].alignments[10].hsps[0].query, "TRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVF--------HADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02598         self.assertEqual(record.rounds[0].alignments[10].hsps[0].match, "+R + I R T+E+ I + ++LDGTGQ  + TG+ F DHMLT L  H+ FDL +   GD E   ++ HH IED AIALG  + + LG+K GIRR+G   IPMDE L    +D+SGRPY V         H  ++G+     Y T +    F +LA NA I LH+   YG++ HHI E  +K+ ARAL+QAV  D  +V  +PS+KG L")
02599         self.assertEqual(record.rounds[0].alignments[10].hsps[0].sbjct, "SRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVE---IEAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSV--PYHTVINRHVFESLAANARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPD-PRVSGVPSTKGAL")
02600         self.assertEqual(record.rounds[0].alignments[10].hsps[0].query_start, 2)
02601         self.assertEqual(record.rounds[0].alignments[10].hsps[0].query_end, 200)
02602         self.assertEqual(record.rounds[0].alignments[10].hsps[0].sbjct_start, 10)
02603         self.assertEqual(record.rounds[0].alignments[10].hsps[0].sbjct_end, 210)
02604         self.assertEqual(record.rounds[0].alignments[11].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02605         self.assertEqual(record.rounds[0].alignments[11].hsps[0].match, "R +H+ RNTKETQI++S+ LD  G + I+TG+GF DHML  +  H  F ++I   GD   + +D HH +ED  +AL + +   L +K GI R+G F +PMDE L  C LDISGRP+L + A+ +  Q++G   TEM E FFR+L++  G+TLHL    G+N HH +E +FK+  R ++QA+ ++      +PSSKGVL")
02606         self.assertEqual(record.rounds[0].alignments[11].hsps[0].sbjct, "RYAHVVRNTKETQIDVSVWLDREGNSKINTGVGFFDHMLDQIATHGGFRMEITVKGD---LYIDDHHTVEDTGLALREALKLALRDKRGICRFG-FVLPMDECL-ACALDISGRPHLEYKAEFT-YQRVGNLSTEMIEHFFRSLSYTMGVTLHLKTK-GKNDHHRVESLFKAFGRTVRQAIRVEGD---TLPSSKGVL")
02607         self.assertEqual(record.rounds[0].alignments[11].hsps[0].query_start, 3)
02608         self.assertEqual(record.rounds[0].alignments[11].hsps[0].query_end, 200)
02609         self.assertEqual(record.rounds[0].alignments[11].hsps[0].sbjct_start, 167)
02610         self.assertEqual(record.rounds[0].alignments[11].hsps[0].sbjct_end, 354)
02611         self.assertEqual(record.rounds[0].alignments[12].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02612         self.assertEqual(record.rounds[0].alignments[12].hsps[0].match, "R S  TR T ET +++ + +DG+G++ ++TG+GFLDHML  +  H   DL++   GD E   +D HH +EDVA+ LG+ + E LG+K GIRR     +PMD+AL T  LD+SGRPY V   +   +  +G   ++    F  +LA +A + +H +   G+N HH  E +FK+ A A++ AV ++    GEIPS+KG L")
02613         self.assertEqual(record.rounds[0].alignments[12].hsps[0].sbjct, "RRSMKTRETLETHVKVDLEIDGSGKSSVNTGLGFLDHMLESVARHGLLDLEVEARGDLE---VDDHHTVEDVALTLGEALREALGDKSGIRRMAHAMVPMDDALATVALDLSGRPYTVLELEFD-DAVIGDVKSQNIGHFIESLAVSAAMNIHASVR-GRNDHHKAEALFKALALAIRDAVRVEH---GEIPSTKGKL")
02614         self.assertEqual(record.rounds[0].alignments[12].hsps[0].query_start, 3)
02615         self.assertEqual(record.rounds[0].alignments[12].hsps[0].query_end, 200)
02616         self.assertEqual(record.rounds[0].alignments[12].hsps[0].sbjct_start, 5)
02617         self.assertEqual(record.rounds[0].alignments[12].hsps[0].sbjct_end, 194)
02618         self.assertEqual(record.rounds[0].alignments[13].hsps[0].query, "RISHITRNTKETQIELSINLDGTG-----QADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02619         self.assertEqual(record.rounds[0].alignments[13].hsps[0].match, "RI+ + R T ET I  +I+LD        + ++STGIGFLDHM T L  H    L++   GD   + +D HH  ED A+ALG+   + LG + GI+RYG    P+DE+L    +DIS RPY + H   +  +K+G   TEM     ++ AF AG+TLH++   G+N HHI E  FK+ A A++ A+S   +   ++PS+KGVL")
02620         self.assertEqual(record.rounds[0].alignments[13].hsps[0].sbjct, "RIASVERTTSETHISCTIDLDHIPGVTEQKINVSTGIGFLDHMFTALAKHGGMSLQLQCKGD---LHIDDHHTAEDCALALGEAFKKALGERKGIKRYGYAYAPLDESLSRAVIDISSRPYFMCHLPFT-REKVGDLSTEMVSHLLQSFAFAAGVTLHIDSIRGENNHHIAESAFKALALAIRMAIS--RTGGDDVPSTKGVL")
02621         self.assertEqual(record.rounds[0].alignments[13].hsps[0].query_start, 3)
02622         self.assertEqual(record.rounds[0].alignments[13].hsps[0].query_end, 200)
02623         self.assertEqual(record.rounds[0].alignments[13].hsps[0].sbjct_start, 4)
02624         self.assertEqual(record.rounds[0].alignments[13].hsps[0].sbjct_end, 200)
02625         self.assertEqual(record.rounds[0].alignments[14].hsps[0].query, "MTRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHML-TLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02626         self.assertEqual(record.rounds[0].alignments[14].hsps[0].match, "M+R ++ITR TKET+IE+ +++D  G+  +ST I F +HML TLLT+ +     I+   D   +  D HH++EDVAI LG  I   LG+K GI+R+    IPMD+ALV   LDIS R     + +L  ++ +GG  TE    FF++ A+N+GITLH+++  G NTHHIIE  FK+   AL +A  I ++   EI S+KG++")
02627         self.assertEqual(record.rounds[0].alignments[14].hsps[0].sbjct, "MSRSANITRETKETKIEVLLDIDRKGEVKVSTPIPFFNHMLITLLTYMNS--TAIVSATDK--LPYDDHHIVEDVAITLGLAIKTALGDKRGIKRFSHQIIPMDDALVLVSLDISNRGMAFVNLNLKRSE-IGGLATENVPHFFQSFAYNSGITLHISQLSGYNTHHIIEASFKALGLALYEATRIVDN---EIRSTKGII")
02628         self.assertEqual(record.rounds[0].alignments[14].hsps[0].query_start, 1)
02629         self.assertEqual(record.rounds[0].alignments[14].hsps[0].query_end, 200)
02630         self.assertEqual(record.rounds[0].alignments[14].hsps[0].sbjct_start, 1)
02631         self.assertEqual(record.rounds[0].alignments[14].hsps[0].sbjct_end, 193)
02632         self.assertEqual(record.rounds[0].alignments[15].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02633         self.assertEqual(record.rounds[0].alignments[15].hsps[0].match, "R ++I+R TKET I + ++LDGTG++ +S+GIGFLDHMLT L  HS FDL++   GD     +D HH  ED A+ LG+     LG++ GI R+GS  +P+DEAL    +DIS R +   +  L     +G   +EM   FF + A  A  TLH++   G+N HH  E  FK+ A AL+ AV  D +    +PS+KGVL")
02634         self.assertEqual(record.rounds[0].alignments[15].hsps[0].sbjct, "REANISRVTKETSISVKLSLDGTGKSKVSSGIGFLDHMLTALAKHSRFDLELDCKGD---TWIDDHHTTEDCALTLGEAFDVALGDRAGIARFGSACVPLDEALSRAIVDISSRAHSEINLQLV-RPSVGELSSEMITHFFESFASAALXTLHVDVLRGRNDHHRAEASFKALAVALRTAVKHDAT--AGVPSTKGVL")
02635         self.assertEqual(record.rounds[0].alignments[15].hsps[0].query_start, 3)
02636         self.assertEqual(record.rounds[0].alignments[15].hsps[0].query_end, 200)
02637         self.assertEqual(record.rounds[0].alignments[15].hsps[0].sbjct_start, 260)
02638         self.assertEqual(record.rounds[0].alignments[15].hsps[0].sbjct_end, 451)
02639         self.assertEqual(record.rounds[0].alignments[16].hsps[0].query, "RISHITRNTKETQIELSINLD-----------------------GTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02640         self.assertEqual(record.rounds[0].alignments[16].hsps[0].match, "R + + RNT ET+I ++I LD                       G     + TGIGFLDHM   L  H+ + L++   GD   + +D HH  ED AIALG    + +GN  G++R+G    P+DEAL    +D+SGRPY V    L   +K+G    EM      + +  AGITLH+   YG N HH  E  FKS A A++ A S+  S   E+PS+KGVL")
02641         self.assertEqual(record.rounds[0].alignments[16].hsps[0].sbjct, "RRAFVERNTNETKISVAIALDKAPLPEESNFIDELITSKHANQKGEQVIQVDTGIGFLDHMYHALAKHAGWSLRLYSRGD---LIIDDHHTAEDTAIALGIAFKQAMGNFAGVKRFGHAYCPLDEALSRSVVDLSGRPYAVIDLGLK-REKVGELSCEMIPHLLYSFSVAAGITLHVTCLYGSNDHHRAESAFKSLAVAMRAATSLTGS--SEVPSTKGVL")
02642         self.assertEqual(record.rounds[0].alignments[16].hsps[0].query_start, 3)
02643         self.assertEqual(record.rounds[0].alignments[16].hsps[0].query_end, 200)
02644         self.assertEqual(record.rounds[0].alignments[16].hsps[0].sbjct_start, 2)
02645         self.assertEqual(record.rounds[0].alignments[16].hsps[0].sbjct_end, 216)
02646         self.assertEqual(record.rounds[0].alignments[17].hsps[0].query, "MTRISHITRNTKETQIELSINLDG---------------------------TGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02647         self.assertEqual(record.rounds[0].alignments[17].hsps[0].match, "M+R + I R T ET+I++++NLDG                           +   ++ TGIGFLDHM+  L  HS + L +   GD   + +D HH  EDV I+LG    + LG   G++R+G    P+DEAL    +D+S RP+ V    L   +K+G   TEM      + A   GIT+H++   G N HH  E  FK+ A A+K+A+S  ++   +IPS+KGVL")
02648         self.assertEqual(record.rounds[0].alignments[17].hsps[0].sbjct, "MSREALINRITNETKIQIALNLDGGKLELKESIFPNQSIIIDEHHAKQVSGSQYINVQTGIGFLDHMIHALAKHSGWSLIVECIGD---LHIDDHHTAEDVGISLGMAFKQALGQIKGVKRFGHGFAPLDEALSRAVVDLSNRPFAVIELGLK-REKIGDLSTEMIPHVLESFAGAVGITIHVDCLRGFNDHHRAESAFKALAIAIKEAIS--KTGKNDIPSTKGVL")
02649         self.assertEqual(record.rounds[0].alignments[17].hsps[0].query_start, 1)
02650         self.assertEqual(record.rounds[0].alignments[17].hsps[0].query_end, 200)
02651         self.assertEqual(record.rounds[0].alignments[17].hsps[0].sbjct_start, 1)
02652         self.assertEqual(record.rounds[0].alignments[17].hsps[0].sbjct_end, 221)
02653         self.assertEqual(record.rounds[0].alignments[18].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKG")
02654         self.assertEqual(record.rounds[0].alignments[18].hsps[0].match, "RI  + R TKET I L IN+DGTG+  I TGI F DH+L     H  FDL +   GD E   +D HH +EDV I LG  +++    K  I R+G   IPMD+A  T  +D+SGR Y V + +    + +G   TE    FF ++A    + +H  E  G+N HH  E +FK+   AL  A  IDE K   + S+KG")
02655         self.assertEqual(record.rounds[0].alignments[18].hsps[0].sbjct, "RIFEVMRETKETNIYLKINIDGTGKYKIDTGIPFFDHLLASFAKHGCFDLIVKARGDLE---IDDHHTVEDVGICLGLALNQI--EKRNIFRFGWAIIPMDDARATVAIDLSGRSYCVGNYE-PKREFVGDLATENINHFFESVASYGMLNIHY-EVIGKNEHHKAEALFKAFGVALDLATKIDERK--GVISTKG")
02656         self.assertEqual(record.rounds[0].alignments[18].hsps[0].query_start, 3)
02657         self.assertEqual(record.rounds[0].alignments[18].hsps[0].query_end, 198)
02658         self.assertEqual(record.rounds[0].alignments[18].hsps[0].sbjct_start, 7)
02659         self.assertEqual(record.rounds[0].alignments[18].hsps[0].sbjct_end, 193)
02660         self.assertEqual(record.rounds[0].alignments[19].hsps[0].query, "RISHITRNTKETQIELSINLDG------------------TGQA------DISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02661         self.assertEqual(record.rounds[0].alignments[19].hsps[0].match, "R + I+R T ET+I+++I+L+G                    QA      DI TG+GFLDHM+  L  HS + L +   GD   + +D HH  ED  IALG+   E +G   G++R+G+   P+DEAL    +D+S RP+ V    L   + +G   TEM   F  + A  A ITLH++   G N HH  E  FK+ A A+++A+S   +   ++PS+KGVL")
02662         self.assertEqual(record.rounds[0].alignments[19].hsps[0].sbjct, "RKAFISRITNETKIQIAISLNGGYIQIKDSILPAKKDDDVASQATQSQVIDIHTGVGFLDHMIHALAKHSGWSLIVECIGD---LHIDDHHTTEDCGIALGQAFKEAMGAVRGVKRFGTGFAPLDEALSRAVVDLSNRPFAVIDLGLK-REMIGDLSTEMIPHFLESFAEAARITLHVDCLRGFNDHHRSESAFKALAVAIREAIS--SNGTNDVPSTKGVL")
02663         self.assertEqual(record.rounds[0].alignments[19].hsps[0].query_start, 3)
02664         self.assertEqual(record.rounds[0].alignments[19].hsps[0].query_end, 200)
02665         self.assertEqual(record.rounds[0].alignments[19].hsps[0].sbjct_start, 16)
02666         self.assertEqual(record.rounds[0].alignments[19].hsps[0].sbjct_end, 231)
02667         self.assertEqual(record.rounds[0].alignments[20].hsps[0].query, "RISHITRNTKETQIELSINLDG-------------------TGQA------DISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02668         self.assertEqual(record.rounds[0].alignments[20].hsps[0].match, "R S I R T ET+I+++++LDG                     QA       ++TGIGFLDHML  L  H  + + I   GD   + +D HH  ED  IALG    E LG+  GI+R+GS   P+DEAL    +D+S RPY V    L   +K+G    EM      + A  A +T+H++   G N HH  E  FK+ A A+K+A+S   +   +IPS+KGVL")
02669         self.assertEqual(record.rounds[0].alignments[20].hsps[0].sbjct, "RSSLIKRITNETKIQIALSLDGGPVSLAQSLFKDKDYSAEHAAQATSSQFISVNTGIGFLDHMLHALAKHGGWSVIIECVGD---LHIDDHHSAEDTGIALGMAFKEALGHVRGIKRFGSGFAPLDEALSRAVIDMSNRPYAVVDLGLK-REKIGDLSCEMIPHVLESFAQGAHVTMHVDCLRGFNDHHRAESAFKALAIAIKEAIS--SNGTDDIPSTKGVL")
02670         self.assertEqual(record.rounds[0].alignments[20].hsps[0].query_start, 3)
02671         self.assertEqual(record.rounds[0].alignments[20].hsps[0].query_end, 200)
02672         self.assertEqual(record.rounds[0].alignments[20].hsps[0].sbjct_start, 7)
02673         self.assertEqual(record.rounds[0].alignments[20].hsps[0].sbjct_end, 223)
02674         self.assertEqual(record.rounds[0].alignments[21].hsps[0].query, "ISHITRNTKETQIELSINLDG-----------------TGQA-DISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02675         self.assertEqual(record.rounds[0].alignments[21].hsps[0].match, "++ + R T+ET I+L+++LDG                  GQ   + TG+GFLDHMLT L  H  + L +   GD   + +D HH +ED  IALG+   E LG+  GI+R+G    P+DEAL    +D S RP+ V    L   +++G   TEM   F  + A    IT+H++   G N HH  E  FK+ A A+++A +   +   ++PS+KGVL")
02676         self.assertEqual(record.rounds[0].alignments[21].hsps[0].sbjct, "MAFVKRVTQETNIQLALDLDGGSVSVRESILGKEYASGDGQTIHVHTGVGFLDHMLTALAKHGGWSLILECIGD---LHIDDHHTVEDCGIALGQAFKEALGSVRGIKRFGHGFAPLDEALSRAVVDFSNRPFAVVELGLK-RERIGQLSTEMIPHFLESFATEGRITMHVDCLRGTNDHHRSESGFKALAIAIREART--PTGRDDVPSTKGVL")
02677         self.assertEqual(record.rounds[0].alignments[21].hsps[0].query_start, 4)
02678         self.assertEqual(record.rounds[0].alignments[21].hsps[0].query_end, 200)
02679         self.assertEqual(record.rounds[0].alignments[21].hsps[0].sbjct_start, 1)
02680         self.assertEqual(record.rounds[0].alignments[21].hsps[0].sbjct_end, 209)
02681         self.assertEqual(record.rounds[0].alignments[22].hsps[0].query, "ITRNTKETQIELSINLDGTGQA------------------------DISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02682         self.assertEqual(record.rounds[0].alignments[22].hsps[0].match, "+ R T ET+I+++I+L G   A                        ++ TGIGFLDHM+  L  HS + L +   GD   + +D HH  ED  IALG+   E LG   G++R+GS   P+DEAL    +D+S RPY V    L   +K+G    EM   F  + A  + ITLH++   G+N HH  E  FK+ A A+++A S   +   ++PS+KGVL")
02683         self.assertEqual(record.rounds[0].alignments[22].hsps[0].sbjct, "VKRITNETKIQIAISLKGGPLAIEHSIFPEKEAEAVAEQATQSQVINVHTGIGFLDHMIHALAKHSGWSLIVECIGD---LHIDDHHTTEDCGIALGQAFKEALGAVRGVKRFGSGFAPLDEALSRAVVDLSNRPYAVVELGLQ-REKVGDLSCEMIPHFLESFAEASRITLHVDCLRGKNDHHRSESAFKALAVAIREATS--PNGTNDVPSTKGVL")
02684         self.assertEqual(record.rounds[0].alignments[22].hsps[0].query_start, 7)
02685         self.assertEqual(record.rounds[0].alignments[22].hsps[0].query_end, 200)
02686         self.assertEqual(record.rounds[0].alignments[22].hsps[0].sbjct_start, 8)
02687         self.assertEqual(record.rounds[0].alignments[22].hsps[0].sbjct_end, 219)
02688         self.assertEqual(record.rounds[0].alignments[23].hsps[0].query, "RISHITRNTKETQIELSINLDG------------------------TGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALK")
02689         self.assertEqual(record.rounds[0].alignments[23].hsps[0].match, "R + ++R+T ET I++++++DG                        +    I+TGIGFLDHML  L  H+ + + +   GD   + +D HH  ED  IA+G   ++ LG   G+ R+G    P+DEAL    +D+S RPY V    L   +KLG    EM     ++ A  A ITLH++   G N HH  E  FK+ A A++")
02690         self.assertEqual(record.rounds[0].alignments[23].hsps[0].sbjct, "RAAALSRDTNETSIQIALSIDGGELPQDADPRLLEASSAHASQTSKSQVISINTGIGFLDHMLHALAKHAGWSMALNCKGD---LHIDDHHTAEDCCIAVGTTFAKALGALTGVARFGYAYAPLDEALSRAVVDLSNRPYTVVDLGLK-REKLGELSCEMIPHCLQSFAQAARITLHVDCLRGDNDHHRAESAFKALAVAVR")
02691         self.assertEqual(record.rounds[0].alignments[23].hsps[0].query_start, 3)
02692         self.assertEqual(record.rounds[0].alignments[23].hsps[0].query_end, 180)
02693         self.assertEqual(record.rounds[0].alignments[23].hsps[0].sbjct_start, 8)
02694         self.assertEqual(record.rounds[0].alignments[23].hsps[0].sbjct_end, 205)
02695         self.assertEqual(record.rounds[0].alignments[24].hsps[0].query, "GDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQK---LGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDES")
02696         self.assertEqual(record.rounds[0].alignments[24].hsps[0].match, "G+   +G  PH  + +++   G  +S  LG+   +      T+   + L T DL+   RPY+ + A ++ N K      YD     +++R +     + L+  +   Q+  HI E    S  R  KQA S +E+")
02697         self.assertEqual(record.rounds[0].alignments[24].hsps[0].sbjct, "GNLHQLGEKPHRAMVELSKTYGPLMSLKLGSVTTVVATSVETVR--DVLKTYDLECCSRPYMTYPARITYNLKDLVFSPYD-----KYWRQVRKLTVVELYTAKRV-QSFRHIREEEVASFVRFNKQAASSEET")
02698         self.assertEqual(record.rounds[0].alignments[24].hsps[0].query_start, 58)
02699         self.assertEqual(record.rounds[0].alignments[24].hsps[0].query_end, 188)
02700         self.assertEqual(record.rounds[0].alignments[24].hsps[0].sbjct_start, 40)
02701         self.assertEqual(record.rounds[0].alignments[24].hsps[0].sbjct_end, 165)
02702         self.assertEqual(record.rounds[0].alignments[25].hsps[0].query, "HSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLG")
02703         self.assertEqual(record.rounds[0].alignments[25].hsps[0].match, "HS+    I+G G H   G DPHH   D  +  G  +  D+G   G")
02704         self.assertEqual(record.rounds[0].alignments[25].hsps[0].sbjct, "HSEVAFVIVGSGPH---GADPHHGYSDRELREGDIVVVDIGGTYG")
02705         self.assertEqual(record.rounds[0].alignments[25].hsps[0].query_start, 47)
02706         self.assertEqual(record.rounds[0].alignments[25].hsps[0].query_end, 91)
02707         self.assertEqual(record.rounds[0].alignments[25].hsps[0].sbjct_start, 195)
02708         self.assertEqual(record.rounds[0].alignments[25].hsps[0].sbjct_end, 236)
02709         self.assertEqual(record.rounds[0].alignments[26].hsps[0].query, "PYLVF---HADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYG")
02710         self.assertEqual(record.rounds[0].alignments[26].hsps[0].match, "PYL+    H D+ GN +  G+  +M +E    L FN  I L  +  YG")
02711         self.assertEqual(record.rounds[0].alignments[26].hsps[0].sbjct, "PYLMLKGNHQDMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYG")
02712         self.assertEqual(record.rounds[0].alignments[26].hsps[0].query_start, 117)
02713         self.assertEqual(record.rounds[0].alignments[26].hsps[0].query_end, 161)
02714         self.assertEqual(record.rounds[0].alignments[26].hsps[0].sbjct_start, 427)
02715         self.assertEqual(record.rounds[0].alignments[26].hsps[0].sbjct_end, 474)
02716         self.assertEqual(record.rounds[0].alignments[27].hsps[0].query, "GKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLG---GYDTEMTEEFFRA")
02717         self.assertEqual(record.rounds[0].alignments[27].hsps[0].match, "GK ISED     GI + G     +D   VT + D  G    +  + L  N++ G    YD E T EF RA")
02718         self.assertEqual(record.rounds[0].alignments[27].hsps[0].sbjct, "GKEISEDKWEDFGISQRGEEKFFIDAEKVTVEFD--GFQAKIQMSSLYKNKQCGLCGHYDGEKTNEFRRA")
02719         self.assertEqual(record.rounds[0].alignments[27].hsps[0].query_start, 79)
02720         self.assertEqual(record.rounds[0].alignments[27].hsps[0].query_end, 145)
02721         self.assertEqual(record.rounds[0].alignments[27].hsps[0].sbjct_start, 1436)
02722         self.assertEqual(record.rounds[0].alignments[27].hsps[0].sbjct_end, 1503)
02723         self.assertEqual(record.rounds[0].alignments[28].hsps[0].query, "PYLVF---HADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYG")
02724         self.assertEqual(record.rounds[0].alignments[28].hsps[0].match, "PYL+    H ++ GN +  G+  +M +E    L FN  I L  +  YG")
02725         self.assertEqual(record.rounds[0].alignments[28].hsps[0].sbjct, "PYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYG")
02726         self.assertEqual(record.rounds[0].alignments[28].hsps[0].query_start, 117)
02727         self.assertEqual(record.rounds[0].alignments[28].hsps[0].query_end, 161)
02728         self.assertEqual(record.rounds[0].alignments[28].hsps[0].sbjct_start, 427)
02729         self.assertEqual(record.rounds[0].alignments[28].hsps[0].sbjct_end, 474)
02730         self.assertEqual(record.rounds[0].alignments[29].hsps[0].query, "RYGSFTIPMDEAL-----VTCDLDISGRPYLVFHADLSGNQKL--GGYDTEMTEEFFRALAFNAG")
02731         self.assertEqual(record.rounds[0].alignments[29].hsps[0].match, "R GS ++P++E          D DI G  Y   H D+  NQ+L  G  D  +++   +   FN+G")
02732         self.assertEqual(record.rounds[0].alignments[29].hsps[0].sbjct, "RNGSNSLPLNEKSNEGESTNVDQDIEGDEYHRLHEDILKNQELDDGSLDDLLSQIIPKITNFNSG")
02733         self.assertEqual(record.rounds[0].alignments[29].hsps[0].query_start, 94)
02734         self.assertEqual(record.rounds[0].alignments[29].hsps[0].query_end, 151)
02735         self.assertEqual(record.rounds[0].alignments[29].hsps[0].sbjct_start, 1141)
02736         self.assertEqual(record.rounds[0].alignments[29].hsps[0].sbjct_end, 1205)
02737         self.assertEqual(record.rounds[1].alignments[0].hsps[0].query, "TRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02738         self.assertEqual(record.rounds[1].alignments[0].hsps[0].match, "TR+  + R TKET + + INLDG+G AD STGI FLDHML  L  H  FD+ +   GD   V +D HH  EDVA+A+G  + + LG++ GI R+G F+ P+DEAL+   LD+SGRP+L ++ D+   Q++G YDT++ E F +++   +G+TLH+ +  G+N+HHIIE  FK+ ARAL+QA   D  + G +PSSKGVL")
02739         self.assertEqual(record.rounds[1].alignments[0].hsps[0].sbjct, "TRVGEVKRVTKETNVSVKINLDGSGVADSSTGIPFLDHMLDQLASHGLFDVHVKATGD---VHIDDHHTNEDVALAIGTALLQALGDRKGINRFGDFSAPLDEALIHVSLDLSGRPHLSYNLDIP-TQRVGTYDTQVVEHFLQSIVNTSGMTLHIRQLAGRNSHHIIEATFKAFARALRQATEYDPRRRGSVPSSKGVL")
02740         self.assertEqual(record.rounds[1].alignments[0].hsps[0].query_start, 2)
02741         self.assertEqual(record.rounds[1].alignments[0].hsps[0].query_end, 200)
02742         self.assertEqual(record.rounds[1].alignments[0].hsps[0].sbjct_start, 84)
02743         self.assertEqual(record.rounds[1].alignments[0].hsps[0].sbjct_end, 278)
02744         self.assertEqual(record.rounds[1].alignments[1].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02745         self.assertEqual(record.rounds[1].alignments[1].hsps[0].match, "RI  + R TKET + + INLDGTG AD S+GI FLDHML  L  H  FD+ +   GD   V +D HH  ED+A+A+G  + + LG + GI R+G FT P+DEAL+   LD+SGRPYL ++ ++   Q++G YDT++ E FF++L   +G+TLH+ +  G+N+HHIIE  FK+ ARAL+QA   D  + G IPSSKGVL")
02746         self.assertEqual(record.rounds[1].alignments[1].hsps[0].sbjct, "RIGEVKRVTKETNVSVKINLDGTGVADSSSGIPFLDHMLDQLASHGLFDVHVRATGD---VHIDDHHTNEDIALAIGTALLKALGERKGINRFGDFTAPLDEALIHVSLDLSGRPYLGYNLEIP-TQRVGTYDTQLVEHFFQSLVNTSGMTLHIRQLAGENSHHIIEATFKAFARALRQATETDPRRGGTIPSSKGVL")
02747         self.assertEqual(record.rounds[1].alignments[1].hsps[0].query_start, 3)
02748         self.assertEqual(record.rounds[1].alignments[1].hsps[0].query_end, 200)
02749         self.assertEqual(record.rounds[1].alignments[1].hsps[0].sbjct_start, 74)
02750         self.assertEqual(record.rounds[1].alignments[1].hsps[0].sbjct_end, 267)
02751         self.assertEqual(record.rounds[1].alignments[2].hsps[0].query, "MTRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02752         self.assertEqual(record.rounds[1].alignments[2].hsps[0].match, "MTRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02753         self.assertEqual(record.rounds[1].alignments[2].hsps[0].sbjct, "MTRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02754         self.assertEqual(record.rounds[1].alignments[2].hsps[0].query_start, 1)
02755         self.assertEqual(record.rounds[1].alignments[2].hsps[0].query_end, 200)
02756         self.assertEqual(record.rounds[1].alignments[2].hsps[0].sbjct_start, 1)
02757         self.assertEqual(record.rounds[1].alignments[2].hsps[0].sbjct_end, 200)
02758         self.assertEqual(record.rounds[1].alignments[3].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02759         self.assertEqual(record.rounds[1].alignments[3].hsps[0].match, "R + + R TKET + +S+NL G+G   ++TG+ FLDHML  +  H   DL++   GD E   +D HH  EDV I LG+ ++E LG++ GI R+G F  P+DEALV   LD SGRP+L +   +   +++G YDT++  EFF A+  ++ +TLH+ +  G N+HHIIE  FK+ ARA++ A+ +D  +   IPSSKGVL")
02760         self.assertEqual(record.rounds[1].alignments[3].hsps[0].sbjct, "RAAAVHRVTKETDVRVSLNLMGSGLCHVATGVPFLDHMLHQIASHGLIDLEVNATGDIE---IDDHHTNEDVGITLGQALAEALGDRRGINRFGHFIAPLDEALVQVTLDFSGRPHLSYGLQIP-TERVGTYDTQLVREFFVAVVNHSQMTLHIRQLDGINSHHIIEATFKAFARAMRMAIEVDPRRADTIPSSKGVL")
02761         self.assertEqual(record.rounds[1].alignments[3].hsps[0].query_start, 3)
02762         self.assertEqual(record.rounds[1].alignments[3].hsps[0].query_end, 200)
02763         self.assertEqual(record.rounds[1].alignments[3].hsps[0].sbjct_start, 17)
02764         self.assertEqual(record.rounds[1].alignments[3].hsps[0].sbjct_end, 210)
02765         self.assertEqual(record.rounds[1].alignments[4].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02766         self.assertEqual(record.rounds[1].alignments[4].hsps[0].match, "RI+ + R T ET +++++NLDGTG    +TGI FLDHML  ++ H   DL +   GD E   +D HH  EDV I LG+ +++ LG++ GI R+G+F  P+DEALV   LD SGRP+L +   +   +++G YDT++  EFF AL  ++ +TLH+ +  G N+HHIIE  FK+ ARA + A+ +D  + G IPSSKGVL")
02767         self.assertEqual(record.rounds[1].alignments[4].hsps[0].sbjct, "RIASVHRITGETNVQVTVNLDGTGICKAATGIPFLDHMLHQISSHGLIDLDVQAKGDWE---IDDHHTNEDVGITLGQALAKALGDRKGIVRFGNFLAPLDEALVQVALDFSGRPHLSYGLQIP-TERVGTYDTQLVREFFVALVNHSQMTLHIRQLDGINSHHIIEATFKAFARAARMAIEVDPRRAGTIPSSKGVL")
02768         self.assertEqual(record.rounds[1].alignments[4].hsps[0].query_start, 3)
02769         self.assertEqual(record.rounds[1].alignments[4].hsps[0].query_end, 200)
02770         self.assertEqual(record.rounds[1].alignments[4].hsps[0].sbjct_start, 16)
02771         self.assertEqual(record.rounds[1].alignments[4].hsps[0].sbjct_end, 209)
02772         self.assertEqual(record.rounds[1].alignments[5].hsps[0].query, "SHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02773         self.assertEqual(record.rounds[1].alignments[5].hsps[0].match, "  + R TKET + + INLDGTG A+ STGI FLDHML  L  H  FD+ +   GD     +D HH  ED+A+A+G  + + LG++ GI R+G FT P+DEA V   LD+SGRP+L     +   +++G YDT++ E FF++L   +G+TLH+ +  G N+HHIIE  FK+ ARAL+QA   D  + G +PSSKGVL")
02774         self.assertEqual(record.rounds[1].alignments[5].hsps[0].sbjct, "GEVKRVTKETNVHVKINLDGTGVANSSTGIPFLDHMLDQLASHGLFDVYVKATGDT---HIDDHHSNEDIALAIGTALLQALGDRKGINRFGHFTAPLDEAAVEVILDLSGRPHLSCGLSIP-TERVGTYDTQLVEHFFQSLVNTSGMTLHIRQLAGNNSHHIIEATFKAFARALRQATEYDLRRQGTMPSSKGVL")
02775         self.assertEqual(record.rounds[1].alignments[5].hsps[0].query_start, 5)
02776         self.assertEqual(record.rounds[1].alignments[5].hsps[0].query_end, 200)
02777         self.assertEqual(record.rounds[1].alignments[5].hsps[0].sbjct_start, 1)
02778         self.assertEqual(record.rounds[1].alignments[5].hsps[0].sbjct_end, 192)
02779         self.assertEqual(record.rounds[1].alignments[6].hsps[0].query, "MTRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02780         self.assertEqual(record.rounds[1].alignments[6].hsps[0].match, "M+R+  + R TKET + + I+LDGTG+ DI+TG+GF DHML  L  H  FDL +   GD   + +D HH IED A+ALG    + LG+K+GI R+G+ T+P+DE+L    +D+SGRPYLV     +    +G YD  MT     +    A + LH++  YG+N HHI+E  FK+ ARAL+ A   D    G +PS+KG L")
02781         self.assertEqual(record.rounds[1].alignments[6].hsps[0].sbjct, "MSRVGRVERTTKETSVLVEIDLDGTGKTDIATGVGFYDHMLDQLGRHGLFDLTVKTDGD---LHIDSHHTIEDTALALGAAFRQALGDKVGIYRFGNCTVPLDESLAQVTVDLSGRPYLVHTEPENMAPMIGEYDVTMTRHILESFVAQAQVALHVHVPYGRNAHHIVECQFKALARALRYASERDPRAAGILPSTKGAL")
02782         self.assertEqual(record.rounds[1].alignments[6].hsps[0].query_start, 1)
02783         self.assertEqual(record.rounds[1].alignments[6].hsps[0].query_end, 200)
02784         self.assertEqual(record.rounds[1].alignments[6].hsps[0].sbjct_start, 1)
02785         self.assertEqual(record.rounds[1].alignments[6].hsps[0].sbjct_end, 197)
02786         self.assertEqual(record.rounds[1].alignments[7].hsps[0].query, "SHITRNTKETQIELSINLDG------------------------TGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02787         self.assertEqual(record.rounds[1].alignments[7].hsps[0].match, "+ + R T ET+I+++I+L G                        +   ++ TGIGFLDHM+  L  HS + L +   GD   + +D HH  ED  IALG+   E LG   G++R+GS   P+DEAL    +D+S RPY V    L   +K+G    EM   F  + A  + ITLH++   G+N HH  E  FK+ A A+++A S   +   ++PS+KGVL")
02788         self.assertEqual(record.rounds[1].alignments[7].hsps[0].sbjct, "ALVKRITNETKIQIAISLKGGPLAIEHSIFPEKEAEAVAEQATQSQVINVHTGIGFLDHMIHALAKHSGWSLIVECIGD---LHIDDHHTTEDCGIALGQAFKEALGAVRGVKRFGSGFAPLDEALSRAVVDLSNRPYAVVELGL-QREKVGDLSCEMIPHFLESFAEASRITLHVDCLRGKNDHHRSESAFKALAVAIREATS--PNGTNDVPSTKGVL")
02789         self.assertEqual(record.rounds[1].alignments[7].hsps[0].query_start, 5)
02790         self.assertEqual(record.rounds[1].alignments[7].hsps[0].query_end, 200)
02791         self.assertEqual(record.rounds[1].alignments[7].hsps[0].sbjct_start, 6)
02792         self.assertEqual(record.rounds[1].alignments[7].hsps[0].sbjct_end, 219)
02793         self.assertEqual(record.rounds[1].alignments[8].hsps[0].query, "MTRISHITRNTKETQIELSINLDG---------------------------TGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02794         self.assertEqual(record.rounds[1].alignments[8].hsps[0].match, "M+R + I R T ET+I++++NLDG                           +   ++ TGIGFLDHM+  L  HS + L +   GD   + +D HH  EDV I+LG    + LG   G++R+G    P+DEAL    +D+S RP+ V    L   +K+G   TEM      + A   GIT+H++   G N HH  E  FK+ A A+K+A+S  ++   +IPS+KGVL")
02795         self.assertEqual(record.rounds[1].alignments[8].hsps[0].sbjct, "MSREALINRITNETKIQIALNLDGGKLELKESIFPNQSIIIDEHHAKQVSGSQYINVQTGIGFLDHMIHALAKHSGWSLIVECIGD---LHIDDHHTAEDVGISLGMAFKQALGQIKGVKRFGHGFAPLDEALSRAVVDLSNRPFAVIELGLK-REKIGDLSTEMIPHVLESFAGAVGITIHVDCLRGFNDHHRAESAFKALAIAIKEAIS--KTGKNDIPSTKGVL")
02796         self.assertEqual(record.rounds[1].alignments[8].hsps[0].query_start, 1)
02797         self.assertEqual(record.rounds[1].alignments[8].hsps[0].query_end, 200)
02798         self.assertEqual(record.rounds[1].alignments[8].hsps[0].sbjct_start, 1)
02799         self.assertEqual(record.rounds[1].alignments[8].hsps[0].sbjct_end, 221)
02800         self.assertEqual(record.rounds[1].alignments[9].hsps[0].query, "RISHITRNTKETQIELSINLDG------------------------TGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02801         self.assertEqual(record.rounds[1].alignments[9].hsps[0].match, "R + I+R T ET+I+++I+L+G                        +   DI TG+GFLDHM+  L  HS + L +   GD   + +D HH  ED  IALG+   E +G   G++R+G+   P+DEAL    +D+S RP+ V    L   + +G   TEM   F  + A  A ITLH++   G N HH  E  FK+ A A+++A+S   +   ++PS+KGVL")
02802         self.assertEqual(record.rounds[1].alignments[9].hsps[0].sbjct, "RKAFISRITNETKIQIAISLNGGYIQIKDSILPAKKDDDVASQATQSQVIDIHTGVGFLDHMIHALAKHSGWSLIVECIGD---LHIDDHHTTEDCGIALGQAFKEAMGAVRGVKRFGTGFAPLDEALSRAVVDLSNRPFAVIDLGLK-REMIGDLSTEMIPHFLESFAEAARITLHVDCLRGFNDHHRSESAFKALAVAIREAIS--SNGTNDVPSTKGVL")
02803         self.assertEqual(record.rounds[1].alignments[9].hsps[0].query_start, 3)
02804         self.assertEqual(record.rounds[1].alignments[9].hsps[0].query_end, 200)
02805         self.assertEqual(record.rounds[1].alignments[9].hsps[0].sbjct_start, 16)
02806         self.assertEqual(record.rounds[1].alignments[9].hsps[0].sbjct_end, 231)
02807         self.assertEqual(record.rounds[1].alignments[10].hsps[0].query, "SHITRNTKETQIELSINLDGTGQA------------------DISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02808         self.assertEqual(record.rounds[1].alignments[10].hsps[0].match, "+ + R T+ET I+L+++LDG   +                   + TG+GFLDHMLT L  H  + L +   GD   + +D HH +ED  IALG+   E LG+  GI+R+G    P+DEAL    +D S RP+ V    L   +++G   TEM   F  + A    IT+H++   G N HH  E  FK+ A A+++A     +   ++PS+KGVL")
02809         self.assertEqual(record.rounds[1].alignments[10].hsps[0].sbjct, "AFVKRVTQETNIQLALDLDGGSVSVRESILGKEYASGDGQTIHVHTGVGFLDHMLTALAKHGGWSLILECIGD---LHIDDHHTVEDCGIALGQAFKEALGSVRGIKRFGHGFAPLDEALSRAVVDFSNRPFAVVELGLK-RERIGQLSTEMIPHFLESFATEGRITMHVDCLRGTNDHHRSESGFKALAIAIREA--RTPTGRDDVPSTKGVL")
02810         self.assertEqual(record.rounds[1].alignments[10].hsps[0].query_start, 5)
02811         self.assertEqual(record.rounds[1].alignments[10].hsps[0].query_end, 200)
02812         self.assertEqual(record.rounds[1].alignments[10].hsps[0].sbjct_start, 2)
02813         self.assertEqual(record.rounds[1].alignments[10].hsps[0].sbjct_end, 209)
02814         self.assertEqual(record.rounds[1].alignments[11].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02815         self.assertEqual(record.rounds[1].alignments[11].hsps[0].match, "R +H+ RNTKETQI++ + LD  G + I+TG+GF DHML  +  H  F ++I   GD   + +D HH +ED  +ALG+ +   LG+K GI R+G F +PMDE L  C LDISGRP+L + A+ +  Q++G   TEM E FFR+L++  G+TLHL    G+N HH +E +FK+  R L+QA+ ++      +PSSKGVL")
02816         self.assertEqual(record.rounds[1].alignments[11].hsps[0].sbjct, "RYAHVVRNTKETQIDVQVWLDREGGSKINTGVGFFDHMLDQIATHGGFRMEINVKGD---LYIDDHHTVEDTGLALGEALKIALGDKRGICRFG-FVLPMDECLARCALDISGRPHLEYKAEFT-YQRVGDLSTEMIEHFFRSLSYTMGVTLHLKT-KGKNDHHRVESLFKAFGRTLRQAIRVEG---DTLPSSKGVL")
02817         self.assertEqual(record.rounds[1].alignments[11].hsps[0].query_start, 3)
02818         self.assertEqual(record.rounds[1].alignments[11].hsps[0].query_end, 200)
02819         self.assertEqual(record.rounds[1].alignments[11].hsps[0].sbjct_start, 167)
02820         self.assertEqual(record.rounds[1].alignments[11].hsps[0].sbjct_end, 355)
02821         self.assertEqual(record.rounds[1].alignments[12].hsps[0].query, "SHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02822         self.assertEqual(record.rounds[1].alignments[12].hsps[0].match, "+ I RNT ET+I +++NLDGTG  D+ TG+GFLDHML  L+ HS  DL +   GD   V +D HH  E   IA+G+ +++ +G++ GI+RYG   +PMDE L    LD S RPYL++    S   K+G  DTE+  E+F+A A  AG+TLH+   YG+N HHI+E  +K+ ARAL+  + ID  K   +PS+KG L")
02823         self.assertEqual(record.rounds[1].alignments[12].hsps[0].sbjct, "ASIERNTTETRIRVAVNLDGTGVYDVKTGVGFLDHMLEQLSRHSLMDLSVAAEGD---VHIDAHHTTEHSGIAIGQAVAKAVGDRKGIQRYGHAYVPMDETLTRVALDFSNRPYLIWKVSFS-RDKIGDMDTELFREWFQAFAMAAGVTLHVECLYGENNHHIVESCYKALARALRAGIEIDPRKRDAVPSTKGTL")
02824         self.assertEqual(record.rounds[1].alignments[12].hsps[0].query_start, 5)
02825         self.assertEqual(record.rounds[1].alignments[12].hsps[0].query_end, 200)
02826         self.assertEqual(record.rounds[1].alignments[12].hsps[0].sbjct_start, 12)
02827         self.assertEqual(record.rounds[1].alignments[12].hsps[0].sbjct_end, 203)
02828         self.assertEqual(record.rounds[1].alignments[13].hsps[0].query, "RISHITRNTKETQIELSINLDG-----TGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02829         self.assertEqual(record.rounds[1].alignments[13].hsps[0].match, "RI+ + R T ET I  +I+LD        + ++STGIGFLDHM T L  H    L++   GD   + +D HH  ED A+ALG+   + LG + GI+RYG    P+DE+L    +DIS RPY + H   +  +K+G   TEM     ++ AF AG+TLH++   G+N HHI E  FK+ A A++ A+S   +   ++PS+KGVL")
02830         self.assertEqual(record.rounds[1].alignments[13].hsps[0].sbjct, "RIASVERTTSETHISCTIDLDHIPGVTEQKINVSTGIGFLDHMFTALAKHGGMSLQLQCKGD---LHIDDHHTAEDCALALGEAFKKALGERKGIKRYGYAYAPLDESLSRAVIDISSRPYFMCHLPFT-REKVGDLSTEMVSHLLQSFAFAAGVTLHIDSIRGENNHHIAESAFKALALAIRMAIS--RTGGDDVPSTKGVL")
02831         self.assertEqual(record.rounds[1].alignments[13].hsps[0].query_start, 3)
02832         self.assertEqual(record.rounds[1].alignments[13].hsps[0].query_end, 200)
02833         self.assertEqual(record.rounds[1].alignments[13].hsps[0].sbjct_start, 4)
02834         self.assertEqual(record.rounds[1].alignments[13].hsps[0].sbjct_end, 200)
02835         self.assertEqual(record.rounds[1].alignments[14].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQA-------------------------DISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02836         self.assertEqual(record.rounds[1].alignments[14].hsps[0].match, "R S I R T ET+I+++++LDG   +                          ++TGIGFLDHML  L  H  + + I   GD   + +D HH  ED  IALG    E LG+  GI+R+GS   P+DEAL    +D+S RPY V    L   +K+G    EM      + A  A +T+H++   G N HH  E  FK+ A A+K+A+S   +   +IPS+KGVL")
02837         self.assertEqual(record.rounds[1].alignments[14].hsps[0].sbjct, "RSSLIKRITNETKIQIALSLDGGPVSLAQSLFKDKDYSAEHAAQATSSQFISVNTGIGFLDHMLHALAKHGGWSVIIECVGD---LHIDDHHSAEDTGIALGMAFKEALGHVRGIKRFGSGFAPLDEALSRAVIDMSNRPYAVVDLGLK-REKIGDLSCEMIPHVLESFAQGAHVTMHVDCLRGFNDHHRAESAFKALAIAIKEAIS--SNGTDDIPSTKGVL")
02838         self.assertEqual(record.rounds[1].alignments[14].hsps[0].query_start, 3)
02839         self.assertEqual(record.rounds[1].alignments[14].hsps[0].query_end, 200)
02840         self.assertEqual(record.rounds[1].alignments[14].hsps[0].sbjct_start, 7)
02841         self.assertEqual(record.rounds[1].alignments[14].hsps[0].sbjct_end, 223)
02842         self.assertEqual(record.rounds[1].alignments[15].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02843         self.assertEqual(record.rounds[1].alignments[15].hsps[0].match, "R + + R TKET I++ + LD  G  +I TG+GF DHML  +  H  F + +   GD   + +D HH +ED A+ALG+ + + +G+K GI R+G F +PMDE    C LD+SGRP++ F+A      K+G + TE+TE FF++LAF+   TLHLN   G N HH IE +FK+  R L+QA+ I+ +   E+PSSKGVL")
02844         self.assertEqual(record.rounds[1].alignments[15].hsps[0].sbjct, "RFAEVIRQTKETDIKVQVWLDEAGVNEIKTGVGFFDHMLDQIATHGGFRMNVQCKGD---LWIDEHHTVEDTALALGQALKQAVGDKRGIARFG-FVLPMDECKAECALDLSGRPWIKFNACFK-RDKVGDFSTELTEHFFQSLAFSMLATLHLNV-TGNNDHHKIESLFKAFGRTLRQAIRIEGN---EMPSSKGVL")
02845         self.assertEqual(record.rounds[1].alignments[15].hsps[0].query_start, 3)
02846         self.assertEqual(record.rounds[1].alignments[15].hsps[0].query_end, 200)
02847         self.assertEqual(record.rounds[1].alignments[15].hsps[0].sbjct_start, 174)
02848         self.assertEqual(record.rounds[1].alignments[15].hsps[0].sbjct_end, 362)
02849         self.assertEqual(record.rounds[1].alignments[16].hsps[0].query, "RISHITRNTKETQIELSINLD-----------------------GTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02850         self.assertEqual(record.rounds[1].alignments[16].hsps[0].match, "R + + RNT ET+I ++I LD                       G     + TGIGFLDHM   L  H+ + L++   GD   + +D HH  ED AIALG    + +GN  G++R+G    P+DEAL    +D+SGRPY V    L   +K+G    EM      + +  AGITLH+   YG N HH  E  FKS A A++ A S+  +   E+PS+KGVL")
02851         self.assertEqual(record.rounds[1].alignments[16].hsps[0].sbjct, "RRAFVERNTNETKISVAIALDKAPLPEESNFIDELITSKHANQKGEQVIQVDTGIGFLDHMYHALAKHAGWSLRLYSRGD---LIIDDHHTAEDTAIALGIAFKQAMGNFAGVKRFGHAYCPLDEALSRSVVDLSGRPYAVIDLGLK-REKVGELSCEMIPHLLYSFSVAAGITLHVTCLYGSNDHHRAESAFKSLAVAMRAATSL--TGSSEVPSTKGVL")
02852         self.assertEqual(record.rounds[1].alignments[16].hsps[0].query_start, 3)
02853         self.assertEqual(record.rounds[1].alignments[16].hsps[0].query_end, 200)
02854         self.assertEqual(record.rounds[1].alignments[16].hsps[0].sbjct_start, 2)
02855         self.assertEqual(record.rounds[1].alignments[16].hsps[0].sbjct_end, 216)
02856         self.assertEqual(record.rounds[1].alignments[17].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGI-TLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02857         self.assertEqual(record.rounds[1].alignments[17].hsps[0].match, "R ++I+R TKET I + ++LDGTG++ +S+GIGFLDHMLT L  HS FDL++   GD     +D HH  ED A+ LG+     LG++ GI R+GS  +P+DEAL    +DIS R +   +  L     +G   +EM   FF + A  A + TLH++   G+N HH  E  FK+ A AL+ AV  D +    +PS+KGVL")
02858         self.assertEqual(record.rounds[1].alignments[17].hsps[0].sbjct, "REANISRVTKETSISVKLSLDGTGKSKVSSGIGFLDHMLTALAKHSRFDLELDCKGDT---WIDDHHTTEDCALTLGEAFDVALGDRAGIARFGSACVPLDEALSRAIVDISSRAHSEINLQLV-RPSVGELSSEMITHFFESFASAA-LXTLHVDVLRGRNDHHRAEASFKALAVALRTAVKHDAT--AGVPSTKGVL")
02859         self.assertEqual(record.rounds[1].alignments[17].hsps[0].query_start, 3)
02860         self.assertEqual(record.rounds[1].alignments[17].hsps[0].query_end, 200)
02861         self.assertEqual(record.rounds[1].alignments[17].hsps[0].sbjct_start, 260)
02862         self.assertEqual(record.rounds[1].alignments[17].hsps[0].sbjct_end, 451)
02863         self.assertEqual(record.rounds[1].alignments[18].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02864         self.assertEqual(record.rounds[1].alignments[18].hsps[0].match, "R +H+ RNTKETQI++S+ LD  G + I+TG+GF DHML  +  H  F ++I   GD   + +D HH +ED  +AL + +   L +K GI R+G F +PMDE L  C LDISGRP+L + A+ +  Q++G   TEM E FFR+L++  G+TLHL    G+N HH +E +FK+  R ++QA+ ++      +PSSKGVL")
02865         self.assertEqual(record.rounds[1].alignments[18].hsps[0].sbjct, "RYAHVVRNTKETQIDVSVWLDREGNSKINTGVGFFDHMLDQIATHGGFRMEITVKGD---LYIDDHHTVEDTGLALREALKLALRDKRGICRFG-FVLPMDECLA-CALDISGRPHLEYKAEFT-YQRVGNLSTEMIEHFFRSLSYTMGVTLHLKT-KGKNDHHRVESLFKAFGRTVRQAIRVEG---DTLPSSKGVL")
02866         self.assertEqual(record.rounds[1].alignments[18].hsps[0].query_start, 3)
02867         self.assertEqual(record.rounds[1].alignments[18].hsps[0].query_end, 200)
02868         self.assertEqual(record.rounds[1].alignments[18].hsps[0].sbjct_start, 167)
02869         self.assertEqual(record.rounds[1].alignments[18].hsps[0].sbjct_end, 354)
02870         self.assertEqual(record.rounds[1].alignments[19].hsps[0].query, "TRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVF--------HADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02871         self.assertEqual(record.rounds[1].alignments[19].hsps[0].match, "+R + I R T+E+ I + ++LDGTGQ  + TG+ F DHMLT L  H+ FDL +   GD E   ++ HH IED AIALG  + + LG+K GIRR+G   IPMDE L    +D+SGRPY V         H  ++G+     Y T +    F +LA NA I LH+   YG++ HHI E  +K+ ARAL+QAV  D   V  +PS+KG L")
02872         self.assertEqual(record.rounds[1].alignments[19].hsps[0].sbjct, "SRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVE---IEAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSV--PYHTVINRHVFESLAANARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPR-VSGVPSTKGAL")
02873         self.assertEqual(record.rounds[1].alignments[19].hsps[0].query_start, 2)
02874         self.assertEqual(record.rounds[1].alignments[19].hsps[0].query_end, 200)
02875         self.assertEqual(record.rounds[1].alignments[19].hsps[0].sbjct_start, 10)
02876         self.assertEqual(record.rounds[1].alignments[19].hsps[0].sbjct_end, 210)
02877         self.assertEqual(record.rounds[1].alignments[20].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02878         self.assertEqual(record.rounds[1].alignments[20].hsps[0].match, "R S  TR T ET +++ + +DG+G++ ++TG+GFLDHML  +  H   DL++   GD E   +D HH +EDVA+ LG+ + E LG+K GIRR     +PMD+AL T  LD+SGRPY V   +   +  +G   ++    F  +LA +A + +H +   G+N HH  E +FK+ A A++ AV ++    GEIPS+KG L")
02879         self.assertEqual(record.rounds[1].alignments[20].hsps[0].sbjct, "RRSMKTRETLETHVKVDLEIDGSGKSSVNTGLGFLDHMLESVARHGLLDLEVEARGDLE---VDDHHTVEDVALTLGEALREALGDKSGIRRMAHAMVPMDDALATVALDLSGRPYTVLELEFD-DAVIGDVKSQNIGHFIESLAVSAAMNIHASV-RGRNDHHKAEALFKALALAIRDAVRVEH---GEIPSTKGKL")
02880         self.assertEqual(record.rounds[1].alignments[20].hsps[0].query_start, 3)
02881         self.assertEqual(record.rounds[1].alignments[20].hsps[0].query_end, 200)
02882         self.assertEqual(record.rounds[1].alignments[20].hsps[0].sbjct_start, 5)
02883         self.assertEqual(record.rounds[1].alignments[20].hsps[0].sbjct_end, 194)
02884         self.assertEqual(record.rounds[1].alignments[21].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKG")
02885         self.assertEqual(record.rounds[1].alignments[21].hsps[0].match, "RI  + R TKET I L IN+DGTG+  I TGI F DH+L     H  FDL +   GD E   +D HH +EDV I LG  +++    K  I R+G   IPMD+A  T  +D+SGR Y V + +    + +G   TE    FF ++A    + +H     G+N HH  E +FK+   AL  A  IDE K   + S+KG")
02886         self.assertEqual(record.rounds[1].alignments[21].hsps[0].sbjct, "RIFEVMRETKETNIYLKINIDGTGKYKIDTGIPFFDHLLASFAKHGCFDLIVKARGDLE---IDDHHTVEDVGICLGLALNQI--EKRNIFRFGWAIIPMDDARATVAIDLSGRSYCVGNYE-PKREFVGDLATENINHFFESVASYGMLNIHYEVI-GKNEHHKAEALFKAFGVALDLATKIDERK--GVISTKG")
02887         self.assertEqual(record.rounds[1].alignments[21].hsps[0].query_start, 3)
02888         self.assertEqual(record.rounds[1].alignments[21].hsps[0].query_end, 198)
02889         self.assertEqual(record.rounds[1].alignments[21].hsps[0].sbjct_start, 7)
02890         self.assertEqual(record.rounds[1].alignments[21].hsps[0].sbjct_end, 193)
02891         self.assertEqual(record.rounds[1].alignments[22].hsps[0].query, "RISHITRNTKETQIELSINLDG------------------------TGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALK")
02892         self.assertEqual(record.rounds[1].alignments[22].hsps[0].match, "R + ++R+T ET I++++++DG                        +    I+TGIGFLDHML  L  H+ + + +   GD   + +D HH  ED  IA+G   ++ LG   G+ R+G    P+DEAL    +D+S RPY V    L   +KLG    EM     ++ A  A ITLH++   G N HH  E  FK+ A A++")
02893         self.assertEqual(record.rounds[1].alignments[22].hsps[0].sbjct, "RAAALSRDTNETSIQIALSIDGGELPQDADPRLLEASSAHASQTSKSQVISINTGIGFLDHMLHALAKHAGWSMALNCKGD---LHIDDHHTAEDCCIAVGTTFAKALGALTGVARFGYAYAPLDEALSRAVVDLSNRPYTVVDLGLK-REKLGELSCEMIPHCLQSFAQAARITLHVDCLRGDNDHHRAESAFKALAVAVR")
02894         self.assertEqual(record.rounds[1].alignments[22].hsps[0].query_start, 3)
02895         self.assertEqual(record.rounds[1].alignments[22].hsps[0].query_end, 180)
02896         self.assertEqual(record.rounds[1].alignments[22].hsps[0].sbjct_start, 8)
02897         self.assertEqual(record.rounds[1].alignments[22].hsps[0].sbjct_end, 205)
02898         self.assertEqual(record.rounds[1].alignments[23].hsps[0].query, "MTRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
02899         self.assertEqual(record.rounds[1].alignments[23].hsps[0].match, "M+R ++ITR TKET+IE+ +++D  G+  +ST I F +HML  L  + +    +      + +  D HH++EDVAI LG  I   LG+K GI+R+    IPMD+ALV   LDIS R     + +L  ++ +GG  TE    FF++ A+N+GITLH+++  G NTHHIIE  FK+   AL +A  I ++   EI S+KG++")
02900         self.assertEqual(record.rounds[1].alignments[23].hsps[0].sbjct, "MSRSANITRETKETKIEVLLDIDRKGEVKVSTPIPFFNHMLITLLTYMNSTAIVSAT---DKLPYDDHHIVEDVAITLGLAIKTALGDKRGIKRFSHQIIPMDDALVLVSLDISNRGMAFVNLNLKRSE-IGGLATENVPHFFQSFAYNSGITLHISQLSGYNTHHIIEASFKALGLALYEATRIVDN---EIRSTKGII")
02901         self.assertEqual(record.rounds[1].alignments[23].hsps[0].query_start, 1)
02902         self.assertEqual(record.rounds[1].alignments[23].hsps[0].query_end, 200)
02903         self.assertEqual(record.rounds[1].alignments[23].hsps[0].sbjct_start, 1)
02904         self.assertEqual(record.rounds[1].alignments[23].hsps[0].sbjct_end, 193)

Here is the caller graph for this function:

def test_NCBITextParser.TestNCBITextParser._check_bt009_round0 (   self,
  record 
) [private]

Definition at line 1943 of file test_NCBITextParser.py.

01943 
01944     def _check_bt009_round0(self, record):
01945         self.assertEqual(record.rounds[0].new_seqs[0].title, "gi|399896|sp|Q02134|HIS7_LACLA IMIDAZOLEGLYCEROL-PHOSPHATE DEHY...")
01946         self.assertEqual(record.rounds[0].new_seqs[0].score, 409)
01947         self.assertAlmostEqual(record.rounds[0].new_seqs[0].e, 1.e-114)
01948         self.assertEqual(record.rounds[0].new_seqs[1].title, "gi|462273|sp|P34047|HIS7_ARATH IMIDAZOLEGLYCEROL-PHOSPHATE DEHY...")
01949         self.assertEqual(record.rounds[0].new_seqs[1].score, 198)
01950         self.assertAlmostEqual(record.rounds[0].new_seqs[1].e, 6e-51)
01951         self.assertEqual(record.rounds[0].new_seqs[2].title, "gi|2495230|sp|Q43072|HIS7_PEA IMIDAZOLEGLYCEROL-PHOSPHATE DEHYD...")
01952         self.assertEqual(record.rounds[0].new_seqs[2].score, 196)
01953         self.assertAlmostEqual(record.rounds[0].new_seqs[2].e, 4e-50)
01954         self.assertEqual(record.rounds[0].new_seqs[3].title, "gi|123157|sp|P18787|HIS7_AZOBR IMIDAZOLEGLYCEROL-PHOSPHATE DEHY...")
01955         self.assertEqual(record.rounds[0].new_seqs[3].score, 185)
01956         self.assertAlmostEqual(record.rounds[0].new_seqs[3].e, 5.e-47)
01957         self.assertEqual(record.rounds[0].new_seqs[4].title, "gi|462275|sp|P34048|HIS7_WHEAT IMIDAZOLEGLYCEROL-PHOSPHATE DEHY...")
01958         self.assertEqual(record.rounds[0].new_seqs[4].score, 181)
01959         self.assertAlmostEqual(record.rounds[0].new_seqs[4].e, 8e-46)
01960         self.assertEqual(record.rounds[0].new_seqs[5].title, "gi|123161|sp|P16247|HIS7_STRCO IMIDAZOLEGLYCEROL-PHOSPHATE DEHY...")
01961         self.assertEqual(record.rounds[0].new_seqs[5].score, 178)
01962         self.assertAlmostEqual(record.rounds[0].new_seqs[5].e, 7e-45)
01963         self.assertEqual(record.rounds[0].new_seqs[6].title, "gi|462272|sp|Q05068|HIS7_ANASP IMIDAZOLEGLYCEROL-PHOSPHATE DEHY...")
01964         self.assertEqual(record.rounds[0].new_seqs[6].score, 178)
01965         self.assertAlmostEqual(record.rounds[0].new_seqs[6].e, 7e-45)
01966         self.assertEqual(record.rounds[0].new_seqs[7].title, "gi|123158|sp|P06987|HIS7_ECOLI HISTIDINE BIOSYNTHESIS BIFUNCTIO...")
01967         self.assertEqual(record.rounds[0].new_seqs[7].score, 175)
01968         self.assertAlmostEqual(record.rounds[0].new_seqs[7].e, 8e-44)
01969         self.assertEqual(record.rounds[0].new_seqs[8].title, "gi|1346293|sp|P48054|HIS7_SYNY3 IMIDAZOLEGLYCEROL-PHOSPHATE DEH...")
01970         self.assertEqual(record.rounds[0].new_seqs[8].score, 174)
01971         self.assertAlmostEqual(record.rounds[0].new_seqs[8].e, 1e-43)
01972         self.assertEqual(record.rounds[0].new_seqs[9].title, "gi|1170286|sp|P44327|HIS7_HAEIN HISTIDINE BIOSYNTHESIS BIFUNCTI...")
01973         self.assertEqual(record.rounds[0].new_seqs[9].score, 168)
01974         self.assertAlmostEqual(record.rounds[0].new_seqs[9].e, 8e-42)
01975         self.assertEqual(record.rounds[0].new_seqs[10].title, "gi|2495224|sp|O06590|HIS7_MYCTU IMIDAZOLEGLYCEROL-PHOSPHATE DEH...")
01976         self.assertEqual(record.rounds[0].new_seqs[10].score, 167)
01977         self.assertAlmostEqual(record.rounds[0].new_seqs[10].e, 2e-41)
01978         self.assertEqual(record.rounds[0].new_seqs[11].title, "gi|123160|sp|P10368|HIS7_SALTY HISTIDINE BIOSYNTHESIS BIFUNCTIO...")
01979         self.assertEqual(record.rounds[0].new_seqs[11].score, 166)
01980         self.assertAlmostEqual(record.rounds[0].new_seqs[11].e, 2e-41)
01981         self.assertEqual(record.rounds[0].new_seqs[12].title, "gi|2495226|sp|Q50504|HIS7_METTH PROBABLE IMIDAZOLEGLYCEROL-PHOS...")
01982         self.assertEqual(record.rounds[0].new_seqs[12].score, 153)
01983         self.assertAlmostEqual(record.rounds[0].new_seqs[12].e, 3e-37)
01984         self.assertEqual(record.rounds[0].new_seqs[13].title, "gi|729718|sp|P40919|HIS7_CRYNE IMIDAZOLEGLYCEROL-PHOSPHATE DEHY...")
01985         self.assertEqual(record.rounds[0].new_seqs[13].score, 152)
01986         self.assertAlmostEqual(record.rounds[0].new_seqs[13].e, 7e-37)
01987         self.assertEqual(record.rounds[0].new_seqs[14].title, "gi|3334215|sp|O33773|HIS7_SULSO PROBABLE IMIDAZOLEGLYCEROL-PHOS...")
01988         self.assertEqual(record.rounds[0].new_seqs[14].score, 151)
01989         self.assertAlmostEqual(record.rounds[0].new_seqs[14].e, 9e-37)
01990         self.assertEqual(record.rounds[0].new_seqs[15].title, "gi|123159|sp|P28624|HIS7_PHYPR IMIDAZOLEGLYCEROL-PHOSPHATE DEHY...")
01991         self.assertEqual(record.rounds[0].new_seqs[15].score, 149)
01992         self.assertAlmostEqual(record.rounds[0].new_seqs[15].e, 3e-36)
01993         self.assertEqual(record.rounds[0].new_seqs[16].title, "gi|729719|sp|P40374|HIS7_SCHPO IMIDAZOLEGLYCEROL-PHOSPHATE DEHY...")
01994         self.assertEqual(record.rounds[0].new_seqs[16].score, 136)
01995         self.assertAlmostEqual(record.rounds[0].new_seqs[16].e, 3e-32)
01996         self.assertEqual(record.rounds[0].new_seqs[17].title, "gi|2495227|sp|P56090|HIS7_CANAL IMIDAZOLEGLYCEROL-PHOSPHATE DEH...")
01997         self.assertEqual(record.rounds[0].new_seqs[17].score, 128)
01998         self.assertAlmostEqual(record.rounds[0].new_seqs[17].e, 9e-30)
01999         self.assertEqual(record.rounds[0].new_seqs[18].title, "gi|2495225|sp|Q58109|HIS7_METJA PROBABLE IMIDAZOLEGLYCEROL-PHOS...")
02000         self.assertEqual(record.rounds[0].new_seqs[18].score, 126)
02001         self.assertAlmostEqual(record.rounds[0].new_seqs[18].e, 4e-29)
02002         self.assertEqual(record.rounds[0].new_seqs[19].title, "gi|399897|sp|Q02986|HIS7_SACKL IMIDAZOLEGLYCEROL-PHOSPHATE DEHY...")
02003         self.assertEqual(record.rounds[0].new_seqs[19].score, 125)
02004         self.assertAlmostEqual(record.rounds[0].new_seqs[19].e, 6e-29)
02005         self.assertEqual(record.rounds[0].new_seqs[20].title, "gi|2495229|sp|Q92447|HIS7_PICPA IMIDAZOLEGLYCEROL-PHOSPHATE DEH...")
02006         self.assertEqual(record.rounds[0].new_seqs[20].score, 125)
02007         self.assertAlmostEqual(record.rounds[0].new_seqs[20].e, 6e-29)
02008         self.assertEqual(record.rounds[0].new_seqs[21].title, "gi|2495228|sp|Q12578|HIS7_CANGA IMIDAZOLEGLYCEROL-PHOSPHATE DEH...")
02009         self.assertEqual(record.rounds[0].new_seqs[21].score, 123)
02010         self.assertAlmostEqual(record.rounds[0].new_seqs[21].e, 2e-28)
02011         self.assertEqual(record.rounds[0].new_seqs[22].title, "gi|2506514|sp|P06633|HIS7_YEAST IMIDAZOLEGLYCEROL-PHOSPHATE DEH...")
02012         self.assertEqual(record.rounds[0].new_seqs[22].score, 122)
02013         self.assertAlmostEqual(record.rounds[0].new_seqs[22].e, 4e-28)
02014         self.assertEqual(record.rounds[0].new_seqs[23].title, "gi|462274|sp|P34041|HIS7_TRIHA IMIDAZOLEGLYCEROL-PHOSPHATE DEHY...")
02015         self.assertEqual(record.rounds[0].new_seqs[23].score, 106)
02016         self.assertAlmostEqual(record.rounds[0].new_seqs[23].e, 3e-23)
02017         self.assertEqual(record.rounds[0].new_seqs[24].title, "gi|1345641|sp|P49264|C7B1_THLAR CYTOCHROME P450 71B1 (CYPLXXIB1)")
02018         self.assertEqual(record.rounds[0].new_seqs[24].score, 35)
02019         self.assertAlmostEqual(record.rounds[0].new_seqs[24].e, 0.13)
02020         self.assertEqual(record.rounds[0].new_seqs[25].title, "gi|1731346|sp|Q10698|YY29_MYCTU PROBABLE DIPEPTIDASE CY49.29C")
02021         self.assertEqual(record.rounds[0].new_seqs[25].score, 32)
02022         self.assertAlmostEqual(record.rounds[0].new_seqs[25].e, 1.1)
02023         self.assertEqual(record.rounds[0].new_seqs[26].title, "gi|3287839|sp|Q01812|GLK4_RAT GLUTAMATE RECEPTOR, IONOTROPIC KA...")
02024         self.assertEqual(record.rounds[0].new_seqs[26].score, 30)
02025         self.assertAlmostEqual(record.rounds[0].new_seqs[26].e, 3.3)
02026         self.assertEqual(record.rounds[0].new_seqs[27].title, "gi|3123025|sp|Q94637|VIT6_OSCBR VITELLOGENIN 6 PRECURSOR")
02027         self.assertEqual(record.rounds[0].new_seqs[27].score, 29)
02028         self.assertAlmostEqual(record.rounds[0].new_seqs[27].e, 5.6)
02029         self.assertEqual(record.rounds[0].new_seqs[28].title, "gi|3287848|sp|Q16099|GLK4_HUMAN GLUTAMATE RECEPTOR, IONOTROPIC ...")
02030         self.assertEqual(record.rounds[0].new_seqs[28].score, 29)
02031         self.assertAlmostEqual(record.rounds[0].new_seqs[28].e, 9.7)
02032         self.assertEqual(record.rounds[0].new_seqs[29].title, "gi|1174406|sp|P36126|SP14_YEAST PHOSPHOLIPASE D1 (PLD 1) (CHOLI...")
02033         self.assertEqual(record.rounds[0].new_seqs[29].score, 29)
02034         self.assertAlmostEqual(record.rounds[0].new_seqs[29].e, 9.7)
02035         self.assertEqual(len(record.rounds[0].alignments), 30)
02036         self.assertEqual(record.rounds[0].alignments[0].title, ">gi|399896|sp|Q02134|HIS7_LACLA IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02037         self.assertEqual(record.rounds[0].alignments[0].length, 200)
02038         self.assertEqual(record.rounds[0].alignments[1].title, ">gi|462273|sp|P34047|HIS7_ARATH IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02039         self.assertEqual(record.rounds[0].alignments[1].length, 270)
02040         self.assertEqual(record.rounds[0].alignments[2].title, ">gi|2495230|sp|Q43072|HIS7_PEA IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02041         self.assertEqual(record.rounds[0].alignments[2].length, 281)
02042         self.assertEqual(record.rounds[0].alignments[3].title, ">gi|123157|sp|P18787|HIS7_AZOBR IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02043         self.assertEqual(record.rounds[0].alignments[3].length, 207)
02044         self.assertEqual(record.rounds[0].alignments[4].title, ">gi|462275|sp|P34048|HIS7_WHEAT IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02045         self.assertEqual(record.rounds[0].alignments[4].length, 195)
02046         self.assertEqual(record.rounds[0].alignments[5].title, ">gi|123161|sp|P16247|HIS7_STRCO IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02047         self.assertEqual(record.rounds[0].alignments[5].length, 197)
02048         self.assertEqual(record.rounds[0].alignments[6].title, ">gi|462272|sp|Q05068|HIS7_ANASP IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02049         self.assertEqual(record.rounds[0].alignments[6].length, 209)
02050         self.assertEqual(record.rounds[0].alignments[7].title, ">gi|123158|sp|P06987|HIS7_ECOLI HISTIDINE BIOSYNTHESIS BIFUNCTIONAL PROTEIN HISB [INCLUDES: IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD); HISTIDINOL-PHOSPHATASE ]")
02051         self.assertEqual(record.rounds[0].alignments[7].length, 355)
02052         self.assertEqual(record.rounds[0].alignments[8].title, ">gi|1346293|sp|P48054|HIS7_SYNY3 IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02053         self.assertEqual(record.rounds[0].alignments[8].length, 210)
02054         self.assertEqual(record.rounds[0].alignments[9].title, ">gi|1170286|sp|P44327|HIS7_HAEIN HISTIDINE BIOSYNTHESIS BIFUNCTIONAL PROTEIN HISB [INCLUDES: IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD); HISTIDINOL-PHOSPHATASE ]")
02055         self.assertEqual(record.rounds[0].alignments[9].length, 362)
02056         self.assertEqual(record.rounds[0].alignments[10].title, ">gi|2495224|sp|O06590|HIS7_MYCTU IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02057         self.assertEqual(record.rounds[0].alignments[10].length, 210)
02058         self.assertEqual(record.rounds[0].alignments[11].title, ">gi|123160|sp|P10368|HIS7_SALTY HISTIDINE BIOSYNTHESIS BIFUNCTIONAL PROTEIN HISB [INCLUDES: IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD); HISTIDINOL-PHOSPHATASE ]")
02059         self.assertEqual(record.rounds[0].alignments[11].length, 354)
02060         self.assertEqual(record.rounds[0].alignments[12].title, ">gi|2495226|sp|Q50504|HIS7_METTH PROBABLE IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02061         self.assertEqual(record.rounds[0].alignments[12].length, 194)
02062         self.assertEqual(record.rounds[0].alignments[13].title, ">gi|729718|sp|P40919|HIS7_CRYNE IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02063         self.assertEqual(record.rounds[0].alignments[13].length, 202)
02064         self.assertEqual(record.rounds[0].alignments[14].title, ">gi|3334215|sp|O33773|HIS7_SULSO PROBABLE IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02065         self.assertEqual(record.rounds[0].alignments[14].length, 193)
02066         self.assertEqual(record.rounds[0].alignments[15].title, ">gi|123159|sp|P28624|HIS7_PHYPR IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02067         self.assertEqual(record.rounds[0].alignments[15].length, 452)
02068         self.assertEqual(record.rounds[0].alignments[16].title, ">gi|729719|sp|P40374|HIS7_SCHPO IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02069         self.assertEqual(record.rounds[0].alignments[16].length, 216)
02070         self.assertEqual(record.rounds[0].alignments[17].title, ">gi|2495227|sp|P56090|HIS7_CANAL IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02071         self.assertEqual(record.rounds[0].alignments[17].length, 223)
02072         self.assertEqual(record.rounds[0].alignments[18].title, ">gi|2495225|sp|Q58109|HIS7_METJA PROBABLE IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02073         self.assertEqual(record.rounds[0].alignments[18].length, 197)
02074         self.assertEqual(record.rounds[0].alignments[19].title, ">gi|399897|sp|Q02986|HIS7_SACKL IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02075         self.assertEqual(record.rounds[0].alignments[19].length, 232)
02076         self.assertEqual(record.rounds[0].alignments[20].title, ">gi|2495229|sp|Q92447|HIS7_PICPA IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02077         self.assertEqual(record.rounds[0].alignments[20].length, 224)
02078         self.assertEqual(record.rounds[0].alignments[21].title, ">gi|2495228|sp|Q12578|HIS7_CANGA IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02079         self.assertEqual(record.rounds[0].alignments[21].length, 210)
02080         self.assertEqual(record.rounds[0].alignments[22].title, ">gi|2506514|sp|P06633|HIS7_YEAST IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02081         self.assertEqual(record.rounds[0].alignments[22].length, 220)
02082         self.assertEqual(record.rounds[0].alignments[23].title, ">gi|462274|sp|P34041|HIS7_TRIHA IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02083         self.assertEqual(record.rounds[0].alignments[23].length, 208)
02084         self.assertEqual(record.rounds[0].alignments[24].title, ">gi|1345641|sp|P49264|C7B1_THLAR CYTOCHROME P450 71B1 (CYPLXXIB1)")
02085         self.assertEqual(record.rounds[0].alignments[24].length, 496)
02086         self.assertEqual(record.rounds[0].alignments[25].title, ">gi|1731346|sp|Q10698|YY29_MYCTU PROBABLE DIPEPTIDASE CY49.29C")
02087         self.assertEqual(record.rounds[0].alignments[25].length, 375)
02088         self.assertEqual(record.rounds[0].alignments[26].title, ">gi|3287839|sp|Q01812|GLK4_RAT GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 4 PRECURSOR (GLUTAMATE RECEPTOR KA-1) (KA1)")
02089         self.assertEqual(record.rounds[0].alignments[26].length, 956)
02090         self.assertEqual(record.rounds[0].alignments[27].title, ">gi|3123025|sp|Q94637|VIT6_OSCBR VITELLOGENIN 6 PRECURSOR")
02091         self.assertEqual(record.rounds[0].alignments[27].length, 1660)
02092         self.assertEqual(record.rounds[0].alignments[28].title, ">gi|3287848|sp|Q16099|GLK4_HUMAN GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 4 PRECURSOR (GLUTAMATE RECEPTOR KA-1) (KA1) (EXCITATORY AMINO ACID RECEPTOR 1) (EAA1)")
02093         self.assertEqual(record.rounds[0].alignments[28].length, 956)
02094         self.assertEqual(record.rounds[0].alignments[29].title, ">gi|1174406|sp|P36126|SP14_YEAST PHOSPHOLIPASE D1 (PLD 1) (CHOLINE PHOSPHATASE 1) (PHOSPHATIDYLCHOLINE-HYDROLYZING PHOSPHOLIPASE D1) (MEIOSIS-SPECIFIC SPORULATION PROTEIN SPO14)")
02095         self.assertEqual(record.rounds[0].alignments[29].length, 1380)

Here is the caller graph for this function:

def test_NCBITextParser.TestNCBITextParser._check_bt009_round1 (   self,
  record 
) [private]

Definition at line 2096 of file test_NCBITextParser.py.

02096 
02097     def _check_bt009_round1(self, record):
02098         self.assertEqual(len(record.rounds[1].new_seqs), 0)
02099         self.assertEqual(len(record.rounds[1].alignments), 24)
02100         self.assertEqual(record.rounds[1].alignments[0].title, ">gi|2495230|sp|Q43072|HIS7_PEA IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02101         self.assertEqual(record.rounds[1].alignments[0].length, 281)
02102         self.assertEqual(record.rounds[1].alignments[1].title, ">gi|462273|sp|P34047|HIS7_ARATH IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02103         self.assertEqual(record.rounds[1].alignments[1].length, 270)
02104         self.assertEqual(record.rounds[1].alignments[2].title, ">gi|399896|sp|Q02134|HIS7_LACLA IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02105         self.assertEqual(record.rounds[1].alignments[2].length, 200)
02106         self.assertEqual(record.rounds[1].alignments[3].title, ">gi|1346293|sp|P48054|HIS7_SYNY3 IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02107         self.assertEqual(record.rounds[1].alignments[3].length, 210)
02108         self.assertEqual(record.rounds[1].alignments[4].title, ">gi|462272|sp|Q05068|HIS7_ANASP IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02109         self.assertEqual(record.rounds[1].alignments[4].length, 209)
02110         self.assertEqual(record.rounds[1].alignments[5].title, ">gi|462275|sp|P34048|HIS7_WHEAT IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02111         self.assertEqual(record.rounds[1].alignments[5].length, 195)
02112         self.assertEqual(record.rounds[1].alignments[6].title, ">gi|123161|sp|P16247|HIS7_STRCO IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02113         self.assertEqual(record.rounds[1].alignments[6].length, 197)
02114         self.assertEqual(record.rounds[1].alignments[7].title, ">gi|2506514|sp|P06633|HIS7_YEAST IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02115         self.assertEqual(record.rounds[1].alignments[7].length, 220)
02116         self.assertEqual(record.rounds[1].alignments[8].title, ">gi|2495227|sp|P56090|HIS7_CANAL IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02117         self.assertEqual(record.rounds[1].alignments[8].length, 223)
02118         self.assertEqual(record.rounds[1].alignments[9].title, ">gi|399897|sp|Q02986|HIS7_SACKL IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02119         self.assertEqual(record.rounds[1].alignments[9].length, 232)
02120         self.assertEqual(record.rounds[1].alignments[10].title, ">gi|2495228|sp|Q12578|HIS7_CANGA IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02121         self.assertEqual(record.rounds[1].alignments[10].length, 210)
02122         self.assertEqual(record.rounds[1].alignments[11].title, ">gi|123158|sp|P06987|HIS7_ECOLI HISTIDINE BIOSYNTHESIS BIFUNCTIONAL PROTEIN HISB [INCLUDES: IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD); HISTIDINOL-PHOSPHATASE ]")
02123         self.assertEqual(record.rounds[1].alignments[11].length, 355)
02124         self.assertEqual(record.rounds[1].alignments[12].title, ">gi|123157|sp|P18787|HIS7_AZOBR IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02125         self.assertEqual(record.rounds[1].alignments[12].length, 207)
02126         self.assertEqual(record.rounds[1].alignments[13].title, ">gi|729718|sp|P40919|HIS7_CRYNE IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02127         self.assertEqual(record.rounds[1].alignments[13].length, 202)
02128         self.assertEqual(record.rounds[1].alignments[14].title, ">gi|2495229|sp|Q92447|HIS7_PICPA IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02129         self.assertEqual(record.rounds[1].alignments[14].length, 224)
02130         self.assertEqual(record.rounds[1].alignments[15].title, ">gi|1170286|sp|P44327|HIS7_HAEIN HISTIDINE BIOSYNTHESIS BIFUNCTIONAL PROTEIN HISB [INCLUDES: IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD); HISTIDINOL-PHOSPHATASE ]")
02131         self.assertEqual(record.rounds[1].alignments[15].length, 362)
02132         self.assertEqual(record.rounds[1].alignments[16].title, ">gi|729719|sp|P40374|HIS7_SCHPO IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02133         self.assertEqual(record.rounds[1].alignments[16].length, 216)
02134         self.assertEqual(record.rounds[1].alignments[17].title, ">gi|123159|sp|P28624|HIS7_PHYPR IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02135         self.assertEqual(record.rounds[1].alignments[17].length, 452)
02136         self.assertEqual(record.rounds[1].alignments[18].title, ">gi|123160|sp|P10368|HIS7_SALTY HISTIDINE BIOSYNTHESIS BIFUNCTIONAL PROTEIN HISB [INCLUDES: IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD); HISTIDINOL-PHOSPHATASE ]")
02137         self.assertEqual(record.rounds[1].alignments[18].length, 354)
02138         self.assertEqual(record.rounds[1].alignments[19].title, ">gi|2495224|sp|O06590|HIS7_MYCTU IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02139         self.assertEqual(record.rounds[1].alignments[19].length, 210)
02140         self.assertEqual(record.rounds[1].alignments[20].title, ">gi|2495226|sp|Q50504|HIS7_METTH PROBABLE IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02141         self.assertEqual(record.rounds[1].alignments[20].length, 194)
02142         self.assertEqual(record.rounds[1].alignments[21].title, ">gi|2495225|sp|Q58109|HIS7_METJA PROBABLE IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02143         self.assertEqual(record.rounds[1].alignments[21].length, 197)
02144         self.assertEqual(record.rounds[1].alignments[22].title, ">gi|462274|sp|P34041|HIS7_TRIHA IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02145         self.assertEqual(record.rounds[1].alignments[22].length, 208)
02146         self.assertEqual(record.rounds[1].alignments[23].title, ">gi|3334215|sp|O33773|HIS7_SULSO PROBABLE IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
02147         self.assertEqual(record.rounds[1].alignments[23].length, 193)
02148         self.assertEqual(record.rounds[0].alignments[0].hsps[0].score, 1040)

Here is the caller graph for this function:

def test_NCBITextParser.TestNCBITextParser._check_bt047_footer (   self,
  record 
) [private]

Definition at line 6721 of file test_NCBITextParser.py.

06721 
06722     def _check_bt047_footer(self, record):
06723         self.assertEqual(record.database_name, ['data/swissprot'])
06724         self.assertEqual(record.num_letters_in_database, [29652561])
06725         self.assertEqual(record.num_sequences_in_database, [82258])
06726         self.assertEqual(record.posted_date, [('Feb 2, 2000  9:39 AM',)])
06727         self.assertEqual(len(record.ka_params), 3)
06728         self.assertAlmostEqual(record.ka_params[0], 0.317)
06729         self.assertAlmostEqual(record.ka_params[1], 0.149)
06730         self.assertAlmostEqual(record.ka_params[2], 0.479)
06731         self.assertEqual(len(record.ka_params_gap), 3)
06732         self.assertAlmostEqual(record.ka_params_gap[0], 0.270)
06733         self.assertAlmostEqual(record.ka_params_gap[1], 0.0524)
06734         self.assertAlmostEqual(record.ka_params_gap[2], 0.230)
06735         self.assertEqual(record.matrix, 'BLOSUM62')
06736         self.assertEqual(record.gap_penalties, [11,1])
06737         self.assertEqual(record.num_hits, 26734132)
06738         self.assertEqual(record.num_sequences, 82258)
06739         self.assertEqual(record.num_extends, 1229035)
06740         self.assertEqual(record.num_good_extends, 2616)
06741         self.assertEqual(record.num_seqs_better_e, 56)
06742         self.assertEqual(record.hsps_no_gap, 48)
06743         self.assertEqual(record.hsps_prelim_gapped, 8)
06744         self.assertEqual(record.hsps_gapped, 58)
06745         self.assertEqual(record.query_length, 200)
06746         self.assertEqual(record.database_length, 29652561)
06747         self.assertEqual(record.effective_hsp_length, 50)
06748         self.assertEqual(record.effective_query_length, 150)
06749         self.assertEqual(record.effective_database_length, 25539661)
06750         self.assertEqual(record.effective_search_space, 3830949150)
06751         self.assertEqual(record.effective_search_space_used, 3830949150)
06752         self.assertEqual(record.threshold, 11)
06753         self.assertEqual(record.window_size, 40)
06754         self.assertEqual(len(record.dropoff_1st_pass), 2)
06755         self.assertEqual(record.dropoff_1st_pass[0], 16)
06756         self.assertAlmostEqual(record.dropoff_1st_pass[1], 7.3)
06757         self.assertEqual(len(record.gap_x_dropoff), 2)
06758         self.assertEqual(record.gap_x_dropoff[0], 38)
06759         self.assertAlmostEqual(record.gap_x_dropoff[1], 14.8)
06760         self.assertEqual(len(record.gap_x_dropoff_final), 2)
06761         self.assertEqual(record.gap_x_dropoff_final[0], 64)
06762         self.assertAlmostEqual(record.gap_x_dropoff_final[1], 24.9)
06763         self.assertEqual(len(record.gap_trigger), 2)
06764         self.assertEqual(record.gap_trigger[0], 41)
06765         self.assertAlmostEqual(record.gap_trigger[1], 21.5)
06766         self.assertEqual(len(record.blast_cutoff), 2)
06767         self.assertEqual(record.blast_cutoff[0], 63)
06768         self.assertAlmostEqual(record.blast_cutoff[1], 28.8)

Here is the caller graph for this function:

def test_NCBITextParser.TestNCBITextParser._check_bt047_hsps (   self,
  record 
) [private]

Definition at line 5936 of file test_NCBITextParser.py.

05936 
05937     def _check_bt047_hsps(self, record):
05938         self.assertEqual(record.rounds[0].alignments[0].hsps[0].score, 1040)
05939         self.assertAlmostEqual(record.rounds[0].alignments[0].hsps[0].bits, 409)
05940         self.assertAlmostEqual(record.rounds[0].alignments[0].hsps[0].expect, 1e-114)
05941         self.assertEqual(len(record.rounds[0].alignments[0].hsps), 1)
05942         self.assertEqual(record.rounds[0].alignments[1].hsps[0].score, 499)
05943         self.assertAlmostEqual(record.rounds[0].alignments[1].hsps[0].bits, 198)
05944         self.assertAlmostEqual(record.rounds[0].alignments[1].hsps[0].expect, 6e-51)
05945         self.assertEqual(len(record.rounds[0].alignments[1].hsps), 1)
05946         self.assertEqual(record.rounds[0].alignments[2].hsps[0].score, 492)
05947         self.assertAlmostEqual(record.rounds[0].alignments[2].hsps[0].bits, 196)
05948         self.assertAlmostEqual(record.rounds[0].alignments[2].hsps[0].expect, 4e-50)
05949         self.assertEqual(len(record.rounds[0].alignments[2].hsps), 1)
05950         self.assertEqual(record.rounds[0].alignments[3].hsps[0].score, 465)
05951         self.assertAlmostEqual(record.rounds[0].alignments[3].hsps[0].bits, 185)
05952         self.assertAlmostEqual(record.rounds[0].alignments[3].hsps[0].expect, 5e-47)
05953         self.assertEqual(len(record.rounds[0].alignments[3].hsps), 1)
05954         self.assertEqual(record.rounds[0].alignments[4].hsps[0].score, 455)
05955         self.assertAlmostEqual(record.rounds[0].alignments[4].hsps[0].bits, 181)
05956         self.assertAlmostEqual(record.rounds[0].alignments[4].hsps[0].expect, 8e-46)
05957         self.assertEqual(len(record.rounds[0].alignments[4].hsps), 1)
05958         self.assertEqual(record.rounds[0].alignments[5].hsps[0].score, 447)
05959         self.assertAlmostEqual(record.rounds[0].alignments[5].hsps[0].bits, 178)
05960         self.assertAlmostEqual(record.rounds[0].alignments[5].hsps[0].expect, 7e-45)
05961         self.assertEqual(len(record.rounds[0].alignments[5].hsps), 1)
05962         self.assertEqual(record.rounds[0].alignments[6].hsps[0].score, 447)
05963         self.assertAlmostEqual(record.rounds[0].alignments[6].hsps[0].bits, 178)
05964         self.assertAlmostEqual(record.rounds[0].alignments[6].hsps[0].expect, 7e-45)
05965         self.assertEqual(len(record.rounds[0].alignments[6].hsps), 1)
05966         self.assertEqual(record.rounds[0].alignments[7].hsps[0].score, 438)
05967         self.assertAlmostEqual(record.rounds[0].alignments[7].hsps[0].bits, 175)
05968         self.assertAlmostEqual(record.rounds[0].alignments[7].hsps[0].expect, 8e-44)
05969         self.assertEqual(len(record.rounds[0].alignments[7].hsps), 1)
05970         self.assertEqual(record.rounds[0].alignments[8].hsps[0].score, 437)
05971         self.assertAlmostEqual(record.rounds[0].alignments[8].hsps[0].bits, 174)
05972         self.assertAlmostEqual(record.rounds[0].alignments[8].hsps[0].expect, 1e-43)
05973         self.assertEqual(len(record.rounds[0].alignments[8].hsps), 1)
05974         self.assertEqual(record.rounds[0].alignments[9].hsps[0].score, 421)
05975         self.assertAlmostEqual(record.rounds[0].alignments[9].hsps[0].bits, 168)
05976         self.assertAlmostEqual(record.rounds[0].alignments[9].hsps[0].expect, 8e-42)
05977         self.assertEqual(len(record.rounds[0].alignments[9].hsps), 1)
05978         self.assertEqual(record.rounds[0].alignments[10].hsps[0].score, 418)
05979         self.assertAlmostEqual(record.rounds[0].alignments[10].hsps[0].bits, 167)
05980         self.assertAlmostEqual(record.rounds[0].alignments[10].hsps[0].expect, 2e-41)
05981         self.assertEqual(len(record.rounds[0].alignments[10].hsps), 1)
05982         self.assertEqual(record.rounds[0].alignments[11].hsps[0].score, 417)
05983         self.assertAlmostEqual(record.rounds[0].alignments[11].hsps[0].bits, 166)
05984         self.assertAlmostEqual(record.rounds[0].alignments[11].hsps[0].expect, 2e-41)
05985         self.assertEqual(len(record.rounds[0].alignments[11].hsps), 1)
05986         self.assertEqual(record.rounds[0].alignments[12].hsps[0].score, 382)
05987         self.assertAlmostEqual(record.rounds[0].alignments[12].hsps[0].bits, 153)
05988         self.assertAlmostEqual(record.rounds[0].alignments[12].hsps[0].expect, 3e-37)
05989         self.assertEqual(len(record.rounds[0].alignments[12].hsps), 1)
05990         self.assertEqual(record.rounds[0].alignments[13].hsps[0].score, 379)
05991         self.assertAlmostEqual(record.rounds[0].alignments[13].hsps[0].bits, 152)
05992         self.assertAlmostEqual(record.rounds[0].alignments[13].hsps[0].expect, 7e-37)
05993         self.assertEqual(len(record.rounds[0].alignments[13].hsps), 1)
05994         self.assertEqual(record.rounds[0].alignments[14].hsps[0].score, 378)
05995         self.assertAlmostEqual(record.rounds[0].alignments[14].hsps[0].bits, 151)
05996         self.assertAlmostEqual(record.rounds[0].alignments[14].hsps[0].expect, 9e-37)
05997         self.assertEqual(len(record.rounds[0].alignments[14].hsps), 1)
05998         self.assertEqual(record.rounds[0].alignments[15].hsps[0].score, 373)
05999         self.assertAlmostEqual(record.rounds[0].alignments[15].hsps[0].bits, 149)
06000         self.assertAlmostEqual(record.rounds[0].alignments[15].hsps[0].expect, 3e-36)
06001         self.assertEqual(len(record.rounds[0].alignments[15].hsps), 1)
06002         self.assertEqual(record.rounds[0].alignments[16].hsps[0].score, 339)
06003         self.assertAlmostEqual(record.rounds[0].alignments[16].hsps[0].bits, 136)
06004         self.assertAlmostEqual(record.rounds[0].alignments[16].hsps[0].expect, 3e-32)
06005         self.assertEqual(len(record.rounds[0].alignments[16].hsps), 1)
06006         self.assertEqual(record.rounds[0].alignments[17].hsps[0].score, 318)
06007         self.assertAlmostEqual(record.rounds[0].alignments[17].hsps[0].bits, 128)
06008         self.assertAlmostEqual(record.rounds[0].alignments[17].hsps[0].expect, 9e-30)
06009         self.assertEqual(len(record.rounds[0].alignments[17].hsps), 1)
06010         self.assertEqual(record.rounds[0].alignments[18].hsps[0].score, 313)
06011         self.assertAlmostEqual(record.rounds[0].alignments[18].hsps[0].bits, 126)
06012         self.assertAlmostEqual(record.rounds[0].alignments[18].hsps[0].expect, 4e-29)
06013         self.assertEqual(len(record.rounds[0].alignments[18].hsps), 1)
06014         self.assertEqual(record.rounds[0].alignments[19].hsps[0].score, 311)
06015         self.assertAlmostEqual(record.rounds[0].alignments[19].hsps[0].bits, 125)
06016         self.assertAlmostEqual(record.rounds[0].alignments[19].hsps[0].expect, 6e-29)
06017         self.assertEqual(len(record.rounds[0].alignments[19].hsps), 1)
06018         self.assertEqual(record.rounds[0].alignments[20].hsps[0].score, 311)
06019         self.assertAlmostEqual(record.rounds[0].alignments[20].hsps[0].bits, 125)
06020         self.assertAlmostEqual(record.rounds[0].alignments[20].hsps[0].expect, 6e-29)
06021         self.assertEqual(len(record.rounds[0].alignments[20].hsps), 1)
06022         self.assertEqual(record.rounds[0].alignments[21].hsps[0].score, 306)
06023         self.assertAlmostEqual(record.rounds[0].alignments[21].hsps[0].bits, 123)
06024         self.assertAlmostEqual(record.rounds[0].alignments[21].hsps[0].expect, 2e-28)
06025         self.assertEqual(len(record.rounds[0].alignments[21].hsps), 1)
06026         self.assertEqual(record.rounds[0].alignments[22].hsps[0].score, 304)
06027         self.assertAlmostEqual(record.rounds[0].alignments[22].hsps[0].bits, 122)
06028         self.assertAlmostEqual(record.rounds[0].alignments[22].hsps[0].expect, 4e-28)
06029         self.assertEqual(len(record.rounds[0].alignments[22].hsps), 1)
06030         self.assertEqual(record.rounds[0].alignments[23].hsps[0].score, 263)
06031         self.assertAlmostEqual(record.rounds[0].alignments[23].hsps[0].bits, 106)
06032         self.assertAlmostEqual(record.rounds[0].alignments[23].hsps[0].expect, 3e-23)
06033         self.assertEqual(len(record.rounds[0].alignments[23].hsps), 1)
06034         self.assertEqual(record.rounds[0].alignments[24].hsps[0].score, 78)
06035         self.assertAlmostEqual(record.rounds[0].alignments[24].hsps[0].bits, 34.8)
06036         self.assertAlmostEqual(record.rounds[0].alignments[24].hsps[0].expect, 0.13)
06037         self.assertEqual(len(record.rounds[0].alignments[24].hsps), 1)
06038         self.assertEqual(record.rounds[0].alignments[25].hsps[0].score, 70)
06039         self.assertAlmostEqual(record.rounds[0].alignments[25].hsps[0].bits, 31.7)
06040         self.assertAlmostEqual(record.rounds[0].alignments[25].hsps[0].expect, 1.1)
06041         self.assertEqual(len(record.rounds[0].alignments[25].hsps), 1)
06042         self.assertEqual(record.rounds[0].alignments[26].hsps[0].score, 66)
06043         self.assertAlmostEqual(record.rounds[0].alignments[26].hsps[0].bits, 30.1)
06044         self.assertAlmostEqual(record.rounds[0].alignments[26].hsps[0].expect, 3.3)
06045         self.assertEqual(len(record.rounds[0].alignments[26].hsps), 1)
06046         self.assertEqual(record.rounds[0].alignments[27].hsps[0].score, 64)
06047         self.assertAlmostEqual(record.rounds[0].alignments[27].hsps[0].bits, 29.3)
06048         self.assertAlmostEqual(record.rounds[0].alignments[27].hsps[0].expect, 5.6)
06049         self.assertEqual(len(record.rounds[0].alignments[27].hsps), 1)
06050         self.assertEqual(record.rounds[0].alignments[28].hsps[0].score, 62)
06051         self.assertAlmostEqual(record.rounds[0].alignments[28].hsps[0].bits, 28.6)
06052         self.assertAlmostEqual(record.rounds[0].alignments[28].hsps[0].expect, 9.7)
06053         self.assertEqual(len(record.rounds[0].alignments[28].hsps), 1)
06054         self.assertEqual(record.rounds[0].alignments[29].hsps[0].score, 62)
06055         self.assertAlmostEqual(record.rounds[0].alignments[29].hsps[0].bits, 28.6)
06056         self.assertAlmostEqual(record.rounds[0].alignments[29].hsps[0].expect, 9.7)
06057         self.assertEqual(record.rounds[1].alignments[0].hsps[0].score, 820)
06058         self.assertAlmostEqual(record.rounds[1].alignments[0].hsps[0].bits, 323)
06059         self.assertAlmostEqual(record.rounds[1].alignments[0].hsps[0].expect, 1e-88)
06060         self.assertEqual(len(record.rounds[1].alignments[0].hsps), 1)
06061         self.assertEqual(record.rounds[1].alignments[1].hsps[0].score, 817)
06062         self.assertAlmostEqual(record.rounds[1].alignments[1].hsps[0].bits, 322)
06063         self.assertAlmostEqual(record.rounds[1].alignments[1].hsps[0].expect, 3e-88)
06064         self.assertEqual(len(record.rounds[1].alignments[1].hsps), 1)
06065         self.assertEqual(record.rounds[1].alignments[2].hsps[0].score, 808)
06066         self.assertAlmostEqual(record.rounds[1].alignments[2].hsps[0].bits, 318)
06067         self.assertAlmostEqual(record.rounds[1].alignments[2].hsps[0].expect, 4e-87)
06068         self.assertEqual(len(record.rounds[1].alignments[2].hsps), 1)
06069         self.assertEqual(record.rounds[1].alignments[3].hsps[0].score, 798)
06070         self.assertAlmostEqual(record.rounds[1].alignments[3].hsps[0].bits, 315)
06071         self.assertAlmostEqual(record.rounds[1].alignments[3].hsps[0].expect, 5e-86)
06072         self.assertEqual(len(record.rounds[1].alignments[3].hsps), 1)
06073         self.assertEqual(record.rounds[1].alignments[4].hsps[0].score, 795)
06074         self.assertAlmostEqual(record.rounds[1].alignments[4].hsps[0].bits, 313)
06075         self.assertAlmostEqual(record.rounds[1].alignments[4].hsps[0].expect, 1e-85)
06076         self.assertEqual(len(record.rounds[1].alignments[4].hsps), 1)
06077         self.assertEqual(record.rounds[1].alignments[5].hsps[0].score, 793)
06078         self.assertAlmostEqual(record.rounds[1].alignments[5].hsps[0].bits, 313)
06079         self.assertAlmostEqual(record.rounds[1].alignments[5].hsps[0].expect, 2e-85)
06080         self.assertEqual(len(record.rounds[1].alignments[5].hsps), 1)
06081         self.assertEqual(record.rounds[1].alignments[6].hsps[0].score, 776)
06082         self.assertAlmostEqual(record.rounds[1].alignments[6].hsps[0].bits, 306)
06083         self.assertAlmostEqual(record.rounds[1].alignments[6].hsps[0].expect, 2e-83)
06084         self.assertEqual(len(record.rounds[1].alignments[6].hsps), 1)
06085         self.assertEqual(record.rounds[1].alignments[7].hsps[0].score, 772)
06086         self.assertAlmostEqual(record.rounds[1].alignments[7].hsps[0].bits, 304)
06087         self.assertAlmostEqual(record.rounds[1].alignments[7].hsps[0].expect, 6e-83)
06088         self.assertEqual(len(record.rounds[1].alignments[7].hsps), 1)
06089         self.assertEqual(record.rounds[1].alignments[8].hsps[0].score, 771)
06090         self.assertAlmostEqual(record.rounds[1].alignments[8].hsps[0].bits, 304)
06091         self.assertAlmostEqual(record.rounds[1].alignments[8].hsps[0].expect, 8e-83)
06092         self.assertEqual(len(record.rounds[1].alignments[8].hsps), 1)
06093         self.assertEqual(record.rounds[1].alignments[9].hsps[0].score, 770)
06094         self.assertAlmostEqual(record.rounds[1].alignments[9].hsps[0].bits, 304)
06095         self.assertAlmostEqual(record.rounds[1].alignments[9].hsps[0].expect, 1e-82)
06096         self.assertEqual(len(record.rounds[1].alignments[9].hsps), 1)
06097         self.assertEqual(record.rounds[1].alignments[10].hsps[0].score, 767)
06098         self.assertAlmostEqual(record.rounds[1].alignments[10].hsps[0].bits, 303)
06099         self.assertAlmostEqual(record.rounds[1].alignments[10].hsps[0].expect, 2e-82)
06100         self.assertEqual(len(record.rounds[1].alignments[10].hsps), 1)
06101         self.assertEqual(record.rounds[1].alignments[11].hsps[0].score, 765)
06102         self.assertAlmostEqual(record.rounds[1].alignments[11].hsps[0].bits, 302)
06103         self.assertAlmostEqual(record.rounds[1].alignments[11].hsps[0].expect, 4e-82)
06104         self.assertEqual(len(record.rounds[1].alignments[11].hsps), 1)
06105         self.assertEqual(record.rounds[1].alignments[12].hsps[0].score, 762)
06106         self.assertAlmostEqual(record.rounds[1].alignments[12].hsps[0].bits, 301)
06107         self.assertAlmostEqual(record.rounds[1].alignments[12].hsps[0].expect, 9e-82)
06108         self.assertEqual(len(record.rounds[1].alignments[12].hsps), 1)
06109         self.assertEqual(record.rounds[1].alignments[13].hsps[0].score, 759)
06110         self.assertAlmostEqual(record.rounds[1].alignments[13].hsps[0].bits, 299)
06111         self.assertAlmostEqual(record.rounds[1].alignments[13].hsps[0].expect, 2e-81)
06112         self.assertEqual(len(record.rounds[1].alignments[13].hsps), 1)
06113         self.assertEqual(record.rounds[1].alignments[14].hsps[0].score, 756)
06114         self.assertAlmostEqual(record.rounds[1].alignments[14].hsps[0].bits, 298)
06115         self.assertAlmostEqual(record.rounds[1].alignments[14].hsps[0].expect, 5e-81)
06116         self.assertEqual(len(record.rounds[1].alignments[14].hsps), 1)
06117         self.assertEqual(record.rounds[1].alignments[15].hsps[0].score, 741)
06118         self.assertAlmostEqual(record.rounds[1].alignments[15].hsps[0].bits, 292)
06119         self.assertAlmostEqual(record.rounds[1].alignments[15].hsps[0].expect, 3e-79)
06120         self.assertEqual(len(record.rounds[1].alignments[15].hsps), 1)
06121         self.assertEqual(record.rounds[1].alignments[16].hsps[0].score, 734)
06122         self.assertAlmostEqual(record.rounds[1].alignments[16].hsps[0].bits, 290)
06123         self.assertAlmostEqual(record.rounds[1].alignments[16].hsps[0].expect, 2e-78)
06124         self.assertEqual(len(record.rounds[1].alignments[16].hsps), 1)
06125         self.assertEqual(record.rounds[1].alignments[17].hsps[0].score, 734)
06126         self.assertAlmostEqual(record.rounds[1].alignments[17].hsps[0].bits, 290)
06127         self.assertAlmostEqual(record.rounds[1].alignments[17].hsps[0].expect, 2e-78)
06128         self.assertEqual(len(record.rounds[1].alignments[17].hsps), 1)
06129         self.assertEqual(record.rounds[1].alignments[18].hsps[0].score, 726)
06130         self.assertAlmostEqual(record.rounds[1].alignments[18].hsps[0].bits, 287)
06131         self.assertAlmostEqual(record.rounds[1].alignments[18].hsps[0].expect, 1e-77)
06132         self.assertEqual(len(record.rounds[1].alignments[18].hsps), 1)
06133         self.assertEqual(record.rounds[1].alignments[19].hsps[0].score, 716)
06134         self.assertAlmostEqual(record.rounds[1].alignments[19].hsps[0].bits, 283)
06135         self.assertAlmostEqual(record.rounds[1].alignments[19].hsps[0].expect, 2e-76)
06136         self.assertEqual(len(record.rounds[1].alignments[19].hsps), 1)
06137         self.assertEqual(record.rounds[1].alignments[20].hsps[0].score, 695)
06138         self.assertAlmostEqual(record.rounds[1].alignments[20].hsps[0].bits, 274)
06139         self.assertAlmostEqual(record.rounds[1].alignments[20].hsps[0].expect, 6e-74)
06140         self.assertEqual(len(record.rounds[1].alignments[20].hsps), 1)
06141         self.assertEqual(record.rounds[1].alignments[21].hsps[0].score, 685)
06142         self.assertAlmostEqual(record.rounds[1].alignments[21].hsps[0].bits, 271)
06143         self.assertAlmostEqual(record.rounds[1].alignments[21].hsps[0].expect, 1e-72)
06144         self.assertEqual(len(record.rounds[1].alignments[21].hsps), 1)
06145         self.assertEqual(record.rounds[1].alignments[22].hsps[0].score, 680)
06146         self.assertAlmostEqual(record.rounds[1].alignments[22].hsps[0].bits, 269)
06147         self.assertAlmostEqual(record.rounds[1].alignments[22].hsps[0].expect, 4e-72)
06148         self.assertEqual(len(record.rounds[1].alignments[22].hsps), 1)
06149         self.assertEqual(record.rounds[1].alignments[23].hsps[0].score, 662)
06150         self.assertAlmostEqual(record.rounds[1].alignments[23].hsps[0].bits, 262)
06151         self.assertAlmostEqual(record.rounds[1].alignments[23].hsps[0].expect, 5e-70)
06152         self.assertEqual(len(record.rounds[1].alignments[23].hsps), 1)
06153         self.assertEqual(record.rounds[1].alignments[24].hsps[0].score, 66)
06154         self.assertAlmostEqual(record.rounds[1].alignments[24].hsps[0].bits, 30.0)
06155         self.assertAlmostEqual(record.rounds[1].alignments[24].hsps[0].expect, 3.7)
06156         self.assertEqual(len(record.rounds[1].alignments[24].hsps), 1)
06157         self.assertEqual(record.rounds[1].alignments[25].hsps[0].score, 63)
06158         self.assertAlmostEqual(record.rounds[1].alignments[25].hsps[0].bits, 28.8)
06159         self.assertAlmostEqual(record.rounds[1].alignments[25].hsps[0].expect, 8.2)
06160         self.assertEqual(len(record.rounds[1].alignments[25].hsps), 1)
        

Here is the caller graph for this function:

Definition at line 6161 of file test_NCBITextParser.py.

06161 
06162     def _check_bt047_hsps_details(self, record):
06163         self.assertEqual(record.rounds[0].alignments[0].hsps[0].identities, (200, 200))
06164         self.assertEqual(record.rounds[0].alignments[0].hsps[0].positives, (200, 200))
06165         self.assertEqual(record.rounds[0].alignments[1].hsps[0].identities, (99, 198))
06166         self.assertEqual(record.rounds[0].alignments[1].hsps[0].positives, (135, 198))
06167         self.assertEqual(record.rounds[0].alignments[1].hsps[0].gaps, (4, 198))
06168         self.assertEqual(record.rounds[0].alignments[2].hsps[0].identities, (96, 199))
06169         self.assertEqual(record.rounds[0].alignments[2].hsps[0].positives, (136, 199))
06170         self.assertEqual(record.rounds[0].alignments[2].hsps[0].gaps, (4, 199))
06171         self.assertEqual(record.rounds[0].alignments[3].hsps[0].identities, (91, 194))
06172         self.assertEqual(record.rounds[0].alignments[3].hsps[0].positives, (126, 194))
06173         self.assertEqual(record.rounds[0].alignments[3].hsps[0].gaps, (4, 194))
06174         self.assertEqual(record.rounds[0].alignments[4].hsps[0].identities, (93, 194))
06175         self.assertEqual(record.rounds[0].alignments[4].hsps[0].positives, (128, 194))
06176         self.assertEqual(record.rounds[0].alignments[4].hsps[0].gaps, (4, 194))
06177         self.assertEqual(record.rounds[0].alignments[5].hsps[0].identities, (89, 200))
06178         self.assertEqual(record.rounds[0].alignments[5].hsps[0].positives, (124, 200))
06179         self.assertEqual(record.rounds[0].alignments[5].hsps[0].gaps, (3, 200))
06180         self.assertEqual(record.rounds[0].alignments[6].hsps[0].identities, (91, 198))
06181         self.assertEqual(record.rounds[0].alignments[6].hsps[0].positives, (131, 198))
06182         self.assertEqual(record.rounds[0].alignments[6].hsps[0].gaps, (4, 198))
06183         self.assertEqual(record.rounds[0].alignments[7].hsps[0].identities, (91, 198))
06184         self.assertEqual(record.rounds[0].alignments[7].hsps[0].positives, (130, 198))
06185         self.assertEqual(record.rounds[0].alignments[7].hsps[0].gaps, (9, 198))
06186         self.assertEqual(record.rounds[0].alignments[8].hsps[0].identities, (88, 198))
06187         self.assertEqual(record.rounds[0].alignments[8].hsps[0].positives, (129, 198))
06188         self.assertEqual(record.rounds[0].alignments[8].hsps[0].gaps, (4, 198))
06189         self.assertEqual(record.rounds[0].alignments[9].hsps[0].identities, (89, 198))
06190         self.assertEqual(record.rounds[0].alignments[9].hsps[0].positives, (127, 198))
06191         self.assertEqual(record.rounds[0].alignments[9].hsps[0].gaps, (9, 198))
06192         self.assertEqual(record.rounds[0].alignments[10].hsps[0].identities, (92, 207))
06193         self.assertEqual(record.rounds[0].alignments[10].hsps[0].positives, (125, 207))
06194         self.assertEqual(record.rounds[0].alignments[10].hsps[0].gaps, (14, 207))
06195         self.assertEqual(record.rounds[0].alignments[11].hsps[0].identities, (89, 198))
06196         self.assertEqual(record.rounds[0].alignments[11].hsps[0].positives, (129, 198))
06197         self.assertEqual(record.rounds[0].alignments[11].hsps[0].gaps, (10, 198))
06198         self.assertEqual(record.rounds[0].alignments[12].hsps[0].identities, (81, 198))
06199         self.assertEqual(record.rounds[0].alignments[12].hsps[0].positives, (122, 198))
06200         self.assertEqual(record.rounds[0].alignments[12].hsps[0].gaps, (8, 198))
06201         self.assertEqual(record.rounds[0].alignments[13].hsps[0].identities, (83, 203))
06202         self.assertEqual(record.rounds[0].alignments[13].hsps[0].positives, (120, 203))
06203         self.assertEqual(record.rounds[0].alignments[13].hsps[0].gaps, (11, 203))
06204         self.assertEqual(record.rounds[0].alignments[14].hsps[0].identities, (88, 201))
06205         self.assertEqual(record.rounds[0].alignments[14].hsps[0].positives, (128, 201))
06206         self.assertEqual(record.rounds[0].alignments[14].hsps[0].gaps, (9, 201))
06207         self.assertEqual(record.rounds[0].alignments[15].hsps[0].identities, (86, 198))
06208         self.assertEqual(record.rounds[0].alignments[15].hsps[0].positives, (120, 198))
06209         self.assertEqual(record.rounds[0].alignments[15].hsps[0].gaps, (6, 198))
06210         self.assertEqual(record.rounds[0].alignments[16].hsps[0].identities, (84, 221))
06211         self.assertEqual(record.rounds[0].alignments[16].hsps[0].positives, (114, 221))
06212         self.assertEqual(record.rounds[0].alignments[16].hsps[0].gaps, (29, 221))
06213         self.assertEqual(record.rounds[0].alignments[17].hsps[0].identities, (81, 227))
06214         self.assertEqual(record.rounds[0].alignments[17].hsps[0].positives, (119, 227))
06215         self.assertEqual(record.rounds[0].alignments[17].hsps[0].gaps, (33, 227))
06216         self.assertEqual(record.rounds[0].alignments[18].hsps[0].identities, (80, 196))
06217         self.assertEqual(record.rounds[0].alignments[18].hsps[0].positives, (107, 196))
06218         self.assertEqual(record.rounds[0].alignments[18].hsps[0].gaps, (9, 196))
06219         self.assertEqual(record.rounds[0].alignments[19].hsps[0].identities, (84, 223))
06220         self.assertEqual(record.rounds[0].alignments[19].hsps[0].positives, (116, 223))
06221         self.assertEqual(record.rounds[0].alignments[19].hsps[0].gaps, (31, 223))
06222         self.assertEqual(record.rounds[0].alignments[20].hsps[0].identities, (81, 222))
06223         self.assertEqual(record.rounds[0].alignments[20].hsps[0].positives, (119, 222))
06224         self.assertEqual(record.rounds[0].alignments[20].hsps[0].gaps, (30, 222))
06225         self.assertEqual(record.rounds[0].alignments[21].hsps[0].identities, (78, 215))
06226         self.assertEqual(record.rounds[0].alignments[21].hsps[0].positives, (116, 215))
06227         self.assertEqual(record.rounds[0].alignments[21].hsps[0].gaps, (24, 215))
06228         self.assertEqual(record.rounds[0].alignments[22].hsps[0].identities, (79, 218))
06229         self.assertEqual(record.rounds[0].alignments[22].hsps[0].positives, (114, 218))
06230         self.assertEqual(record.rounds[0].alignments[22].hsps[0].gaps, (30, 218))
06231         self.assertEqual(record.rounds[0].alignments[23].hsps[0].identities, (68, 202))
06232         self.assertEqual(record.rounds[0].alignments[23].hsps[0].positives, (102, 202))
06233         self.assertEqual(record.rounds[0].alignments[23].hsps[0].gaps, (28, 202))
06234         self.assertEqual(record.rounds[0].alignments[24].hsps[0].identities, (34, 134))
06235         self.assertEqual(record.rounds[0].alignments[24].hsps[0].positives, (60, 134))
06236         self.assertEqual(record.rounds[0].alignments[24].hsps[0].gaps, (11, 134))
06237         self.assertEqual(record.rounds[0].alignments[25].hsps[0].identities, (16, 45))
06238         self.assertEqual(record.rounds[0].alignments[25].hsps[0].positives, (21, 45))
06239         self.assertEqual(record.rounds[0].alignments[25].hsps[0].gaps, (3, 45))
06240         self.assertEqual(record.rounds[0].alignments[26].hsps[0].identities, (17, 48))
06241         self.assertEqual(record.rounds[0].alignments[26].hsps[0].positives, (24, 48))
06242         self.assertEqual(record.rounds[0].alignments[26].hsps[0].gaps, (3, 48))
06243         self.assertEqual(record.rounds[0].alignments[27].hsps[0].identities, (25, 70))
06244         self.assertEqual(record.rounds[0].alignments[27].hsps[0].positives, (32, 70))
06245         self.assertEqual(record.rounds[0].alignments[27].hsps[0].gaps, (5, 70))
06246         self.assertEqual(record.rounds[0].alignments[28].hsps[0].identities, (20, 65))
06247         self.assertEqual(record.rounds[0].alignments[28].hsps[0].positives, (31, 65))
06248         self.assertEqual(record.rounds[0].alignments[28].hsps[0].gaps, (7, 65))
06249         self.assertEqual(record.rounds[0].alignments[29].hsps[0].identities, (16, 48))
06250         self.assertEqual(record.rounds[0].alignments[29].hsps[0].positives, (24, 48))
06251         self.assertEqual(record.rounds[0].alignments[29].hsps[0].gaps, (3, 48))
06252         self.assertEqual(record.rounds[1].alignments[0].hsps[0].identities, (96, 199))
06253         self.assertEqual(record.rounds[1].alignments[0].hsps[0].positives, (136, 199))
06254         self.assertEqual(record.rounds[1].alignments[0].hsps[0].gaps, (4, 199))
06255         self.assertEqual(record.rounds[1].alignments[1].hsps[0].identities, (99, 198))
06256         self.assertEqual(record.rounds[1].alignments[1].hsps[0].positives, (135, 198))
06257         self.assertEqual(record.rounds[1].alignments[1].hsps[0].gaps, (4, 198))
06258         self.assertEqual(record.rounds[1].alignments[2].hsps[0].identities, (200, 200))
06259         self.assertEqual(record.rounds[1].alignments[2].hsps[0].positives, (200, 200))
06260         self.assertEqual(record.rounds[1].alignments[3].hsps[0].identities, (88, 198))
06261         self.assertEqual(record.rounds[1].alignments[3].hsps[0].positives, (129, 198))
06262         self.assertEqual(record.rounds[1].alignments[3].hsps[0].gaps, (4, 198))
06263         self.assertEqual(record.rounds[1].alignments[4].hsps[0].identities, (91, 198))
06264         self.assertEqual(record.rounds[1].alignments[4].hsps[0].positives, (131, 198))
06265         self.assertEqual(record.rounds[1].alignments[4].hsps[0].gaps, (4, 198))
06266         self.assertEqual(record.rounds[1].alignments[5].hsps[0].identities, (93, 196))
06267         self.assertEqual(record.rounds[1].alignments[5].hsps[0].positives, (128, 196))
06268         self.assertEqual(record.rounds[1].alignments[5].hsps[0].gaps, (4, 196))
06269         self.assertEqual(record.rounds[1].alignments[6].hsps[0].identities, (89, 200))
06270         self.assertEqual(record.rounds[1].alignments[6].hsps[0].positives, (124, 200))
06271         self.assertEqual(record.rounds[1].alignments[6].hsps[0].gaps, (3, 200))
06272         self.assertEqual(record.rounds[1].alignments[7].hsps[0].identities, (78, 220))
06273         self.assertEqual(record.rounds[1].alignments[7].hsps[0].positives, (115, 220))
06274         self.assertEqual(record.rounds[1].alignments[7].hsps[0].gaps, (30, 220))
06275         self.assertEqual(record.rounds[1].alignments[8].hsps[0].identities, (81, 227))
06276         self.assertEqual(record.rounds[1].alignments[8].hsps[0].positives, (119, 227))
06277         self.assertEqual(record.rounds[1].alignments[8].hsps[0].gaps, (33, 227))
06278         self.assertEqual(record.rounds[1].alignments[9].hsps[0].identities, (79, 222))
06279         self.assertEqual(record.rounds[1].alignments[9].hsps[0].positives, (118, 222))
06280         self.assertEqual(record.rounds[1].alignments[9].hsps[0].gaps, (30, 222))
06281         self.assertEqual(record.rounds[1].alignments[10].hsps[0].identities, (76, 214))
06282         self.assertEqual(record.rounds[1].alignments[10].hsps[0].positives, (113, 214))
06283         self.assertEqual(record.rounds[1].alignments[10].hsps[0].gaps, (24, 214))
06284         self.assertEqual(record.rounds[1].alignments[11].hsps[0].identities, (91, 198))
06285         self.assertEqual(record.rounds[1].alignments[11].hsps[0].positives, (130, 198))
06286         self.assertEqual(record.rounds[1].alignments[11].hsps[0].gaps, (9, 198))
06287         self.assertEqual(record.rounds[1].alignments[12].hsps[0].identities, (91, 196))
06288         self.assertEqual(record.rounds[1].alignments[12].hsps[0].positives, (127, 196))
06289         self.assertEqual(record.rounds[1].alignments[12].hsps[0].gaps, (4, 196))
06290         self.assertEqual(record.rounds[1].alignments[13].hsps[0].identities, (83, 203))
06291         self.assertEqual(record.rounds[1].alignments[13].hsps[0].positives, (120, 203))
06292         self.assertEqual(record.rounds[1].alignments[13].hsps[0].gaps, (11, 203))
06293         self.assertEqual(record.rounds[1].alignments[14].hsps[0].identities, (82, 223))
06294         self.assertEqual(record.rounds[1].alignments[14].hsps[0].positives, (115, 223))
06295         self.assertEqual(record.rounds[1].alignments[14].hsps[0].gaps, (31, 223))
06296         self.assertEqual(record.rounds[1].alignments[15].hsps[0].identities, (89, 198))
06297         self.assertEqual(record.rounds[1].alignments[15].hsps[0].positives, (127, 198))
06298         self.assertEqual(record.rounds[1].alignments[15].hsps[0].gaps, (9, 198))
06299         self.assertEqual(record.rounds[1].alignments[16].hsps[0].identities, (86, 199))
06300         self.assertEqual(record.rounds[1].alignments[16].hsps[0].positives, (121, 199))
06301         self.assertEqual(record.rounds[1].alignments[16].hsps[0].gaps, (8, 199))
06302         self.assertEqual(record.rounds[1].alignments[17].hsps[0].identities, (83, 221))
06303         self.assertEqual(record.rounds[1].alignments[17].hsps[0].positives, (114, 221))
06304         self.assertEqual(record.rounds[1].alignments[17].hsps[0].gaps, (29, 221))
06305         self.assertEqual(record.rounds[1].alignments[18].hsps[0].identities, (89, 198))
06306         self.assertEqual(record.rounds[1].alignments[18].hsps[0].positives, (129, 198))
06307         self.assertEqual(record.rounds[1].alignments[18].hsps[0].gaps, (10, 198))
06308         self.assertEqual(record.rounds[1].alignments[19].hsps[0].identities, (92, 207))
06309         self.assertEqual(record.rounds[1].alignments[19].hsps[0].positives, (124, 207))
06310         self.assertEqual(record.rounds[1].alignments[19].hsps[0].gaps, (14, 207))
06311         self.assertEqual(record.rounds[1].alignments[20].hsps[0].identities, (81, 198))
06312         self.assertEqual(record.rounds[1].alignments[20].hsps[0].positives, (122, 198))
06313         self.assertEqual(record.rounds[1].alignments[20].hsps[0].gaps, (8, 198))
06314         self.assertEqual(record.rounds[1].alignments[21].hsps[0].identities, (79, 196))
06315         self.assertEqual(record.rounds[1].alignments[21].hsps[0].positives, (106, 196))
06316         self.assertEqual(record.rounds[1].alignments[21].hsps[0].gaps, (9, 196))
06317         self.assertEqual(record.rounds[1].alignments[22].hsps[0].identities, (68, 202))
06318         self.assertEqual(record.rounds[1].alignments[22].hsps[0].positives, (102, 202))
06319         self.assertEqual(record.rounds[1].alignments[22].hsps[0].gaps, (28, 202))
06320         self.assertEqual(record.rounds[1].alignments[23].hsps[0].identities, (83, 200))
06321         self.assertEqual(record.rounds[1].alignments[23].hsps[0].positives, (124, 200))
06322         self.assertEqual(record.rounds[1].alignments[23].hsps[0].gaps, (7, 200))
06323         self.assertEqual(record.rounds[1].alignments[24].hsps[0].identities, (18, 120))
06324         self.assertEqual(record.rounds[1].alignments[24].hsps[0].positives, (39, 120))
06325         self.assertEqual(record.rounds[1].alignments[24].hsps[0].gaps, (19, 120))
06326         self.assertEqual(record.rounds[1].alignments[25].hsps[0].identities, (18, 120))
06327         self.assertEqual(record.rounds[1].alignments[25].hsps[0].positives, (37, 120))
06328         self.assertEqual(record.rounds[1].alignments[25].hsps[0].gaps, (19, 120))
06329         self.assertEqual(record.rounds[0].alignments[0].hsps[0].query, "MTRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06330         self.assertEqual(record.rounds[0].alignments[0].hsps[0].match, "MTRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06331         self.assertEqual(record.rounds[0].alignments[0].hsps[0].sbjct, "MTRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06332         self.assertEqual(record.rounds[0].alignments[0].hsps[0].query_start, 1)
06333         self.assertEqual(record.rounds[0].alignments[0].hsps[0].query_end, 200)
06334         self.assertEqual(record.rounds[0].alignments[0].hsps[0].sbjct_start, 1)
06335         self.assertEqual(record.rounds[0].alignments[0].hsps[0].sbjct_end, 200)
06336         self.assertEqual(record.rounds[0].alignments[1].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06337         self.assertEqual(record.rounds[0].alignments[1].hsps[0].match, "RI  + R TKET + + INLDGTG AD S+GI FLDHML  L  H  FD+ +   GD   V +D HH  ED+A+A+G  + + LG + GI R+G FT P+DEAL+   LD+SGRPYL ++ ++   Q++G YDT++ E FF++L   +G+TLH+ +  G+N+HHIIE  FK+ ARAL+QA   D  + G IPSSKGVL")
06338         self.assertEqual(record.rounds[0].alignments[1].hsps[0].sbjct, "RIGEVKRVTKETNVSVKINLDGTGVADSSSGIPFLDHMLDQLASHGLFDVHVRATGD---VHIDDHHTNEDIALAIGTALLKALGERKGINRFGDFTAPLDEALIHVSLDLSGRPYLGYNLEIP-TQRVGTYDTQLVEHFFQSLVNTSGMTLHIRQLAGENSHHIIEATFKAFARALRQATETDPRRGGTIPSSKGVL")
06339         self.assertEqual(record.rounds[0].alignments[1].hsps[0].query_start, 3)
06340         self.assertEqual(record.rounds[0].alignments[1].hsps[0].query_end, 200)
06341         self.assertEqual(record.rounds[0].alignments[1].hsps[0].sbjct_start, 74)
06342         self.assertEqual(record.rounds[0].alignments[1].hsps[0].sbjct_end, 267)
06343         self.assertEqual(record.rounds[0].alignments[2].hsps[0].query, "TRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06344         self.assertEqual(record.rounds[0].alignments[2].hsps[0].match, "TR+  + R TKET + + INLDG+G AD STGI FLDHML  L  H  FD+ +   GD   V +D HH  EDVA+A+G  + + LG++ GI R+G F+ P+DEAL+   LD+SGRP+L ++ D+   Q++G YDT++ E F +++   +G+TLH+ +  G+N+HHIIE  FK+ ARAL+QA   D  + G +PSSKGVL")
06345         self.assertEqual(record.rounds[0].alignments[2].hsps[0].sbjct, "TRVGEVKRVTKETNVSVKINLDGSGVADSSTGIPFLDHMLDQLASHGLFDVHVKATGD---VHIDDHHTNEDVALAIGTALLQALGDRKGINRFGDFSAPLDEALIHVSLDLSGRPHLSYNLDIP-TQRVGTYDTQVVEHFLQSIVNTSGMTLHIRQLAGRNSHHIIEATFKAFARALRQATEYDPRRRGSVPSSKGVL")
06346         self.assertEqual(record.rounds[0].alignments[2].hsps[0].query_start, 2)
06347         self.assertEqual(record.rounds[0].alignments[2].hsps[0].query_end, 200)
06348         self.assertEqual(record.rounds[0].alignments[2].hsps[0].sbjct_start, 84)
06349         self.assertEqual(record.rounds[0].alignments[2].hsps[0].sbjct_end, 278)
06350         self.assertEqual(record.rounds[0].alignments[3].hsps[0].query, "ITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06351         self.assertEqual(record.rounds[0].alignments[3].hsps[0].match, "I RNT ET+I +++NLDGTG  D+ TG+GFLDHML  L+ HS  DL +   GD   V +D HH  E   IA+G+ +++ +G++ GI+RYG   +PMDE L    LD S RPYL++    S   K+G  DTE+  E+F+A A  AG+TLH+   YG+N HHI+E  +K+ ARAL+  + ID  K   +PS+KG L")
06352         self.assertEqual(record.rounds[0].alignments[3].hsps[0].sbjct, "IERNTTETRIRVAVNLDGTGVYDVKTGVGFLDHMLEQLSRHSLMDLSVAAEGD---VHIDAHHTTEHSGIAIGQAVAKAVGDRKGIQRYGHAYVPMDETLTRVALDFSNRPYLIWKVSFS-RDKIGDMDTELFREWFQAFAMAAGVTLHVECLYGENNHHIVESCYKALARALRAGIEIDPRKRDAVPSTKGTL")
06353         self.assertEqual(record.rounds[0].alignments[3].hsps[0].query_start, 7)
06354         self.assertEqual(record.rounds[0].alignments[3].hsps[0].query_end, 200)
06355         self.assertEqual(record.rounds[0].alignments[3].hsps[0].sbjct_start, 14)
06356         self.assertEqual(record.rounds[0].alignments[3].hsps[0].sbjct_end, 203)
06357         self.assertEqual(record.rounds[0].alignments[4].hsps[0].query, "ITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06358         self.assertEqual(record.rounds[0].alignments[4].hsps[0].match, "+ R TKET + + INLDGTG A+ STGI FLDHML  L  H  FD+ +   GD     +D HH  ED+A+A+G  + + LG++ GI R+G FT P+DEA V   LD+SGRP+L     +   +++G YDT++ E FF++L   +G+TLH+ +  G N+HHIIE  FK+ ARAL+QA   D  + G +PSSKGVL")
06359         self.assertEqual(record.rounds[0].alignments[4].hsps[0].sbjct, "VKRVTKETNVHVKINLDGTGVANSSTGIPFLDHMLDQLASHGLFDVYVKATGDTH---IDDHHSNEDIALAIGTALLQALGDRKGINRFGHFTAPLDEAAVEVILDLSGRPHLSCGLSIP-TERVGTYDTQLVEHFFQSLVNTSGMTLHIRQLAGNNSHHIIEATFKAFARALRQATEYDLRRQGTMPSSKGVL")
06360         self.assertEqual(record.rounds[0].alignments[4].hsps[0].query_start, 7)
06361         self.assertEqual(record.rounds[0].alignments[4].hsps[0].query_end, 200)
06362         self.assertEqual(record.rounds[0].alignments[4].hsps[0].sbjct_start, 3)
06363         self.assertEqual(record.rounds[0].alignments[4].hsps[0].sbjct_end, 192)
06364         self.assertEqual(record.rounds[0].alignments[5].hsps[0].query, "MTRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06365         self.assertEqual(record.rounds[0].alignments[5].hsps[0].match, "M+R+  + R TKET + + I+LDGTG+ DI+TG+GF DHML  L  H  FDL +   GD   + +D HH IED A+ALG    + LG+K+GI R+G+ T+P+DE+L    +D+SGRPYLV     +    +G YD  MT     +    A + LH++  YG+N HHI+E  FK+ ARAL+ A   D    G +PS+KG L")
06366         self.assertEqual(record.rounds[0].alignments[5].hsps[0].sbjct, "MSRVGRVERTTKETSVLVEIDLDGTGKTDIATGVGFYDHMLDQLGRHGLFDLTVKTDGD---LHIDSHHTIEDTALALGAAFRQALGDKVGIYRFGNCTVPLDESLAQVTVDLSGRPYLVHTEPENMAPMIGEYDVTMTRHILESFVAQAQVALHVHVPYGRNAHHIVECQFKALARALRYASERDPRAAGILPSTKGAL")
06367         self.assertEqual(record.rounds[0].alignments[5].hsps[0].query_start, 1)
06368         self.assertEqual(record.rounds[0].alignments[5].hsps[0].query_end, 200)
06369         self.assertEqual(record.rounds[0].alignments[5].hsps[0].sbjct_start, 1)
06370         self.assertEqual(record.rounds[0].alignments[5].hsps[0].sbjct_end, 197)
06371         self.assertEqual(record.rounds[0].alignments[6].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06372         self.assertEqual(record.rounds[0].alignments[6].hsps[0].match, "RI+ + R T ET +++++NLDGTG    +TGI FLDHML  ++ H   DL +   GD E   +D HH  EDV I LG+ +++ LG++ GI R+G+F  P+DEALV   LD SGRP+L +   +   +++G YDT++  EFF AL  ++ +TLH+ +  G N+HHIIE  FK+ ARA + A+ +D  + G IPSSKGVL")
06373         self.assertEqual(record.rounds[0].alignments[6].hsps[0].sbjct, "RIASVHRITGETNVQVTVNLDGTGICKAATGIPFLDHMLHQISSHGLIDLDVQAKGDWE---IDDHHTNEDVGITLGQALAKALGDRKGIVRFGNFLAPLDEALVQVALDFSGRPHLSYGLQIP-TERVGTYDTQLVREFFVALVNHSQMTLHIRQLDGINSHHIIEATFKAFARAARMAIEVDPRRAGTIPSSKGVL")
06374         self.assertEqual(record.rounds[0].alignments[6].hsps[0].query_start, 3)
06375         self.assertEqual(record.rounds[0].alignments[6].hsps[0].query_end, 200)
06376         self.assertEqual(record.rounds[0].alignments[6].hsps[0].sbjct_start, 16)
06377         self.assertEqual(record.rounds[0].alignments[6].hsps[0].sbjct_end, 209)
06378         self.assertEqual(record.rounds[0].alignments[7].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06379         self.assertEqual(record.rounds[0].alignments[7].hsps[0].match, "R +H+ RNTKETQI++ + LD  G + I+TG+GF DHML  +  H  F ++I   GD   + +D HH +ED  +ALG+ +   LG+K GI R+G F +PMDE L  C LDISGRP+L + A+ +  Q++G   TEM E FFR+L++  G+TLHL    G+N HH +E +FK+  R L+QA+ ++      +PSSKGVL")
06380         self.assertEqual(record.rounds[0].alignments[7].hsps[0].sbjct, "RYAHVVRNTKETQIDVQVWLDREGGSKINTGVGFFDHMLDQIATHGGFRMEINVKGD---LYIDDHHTVEDTGLALGEALKIALGDKRGICRFG-FVLPMDECLARCALDISGRPHLEYKAEFT-YQRVGDLSTEMIEHFFRSLSYTMGVTLHLKTK-GKNDHHRVESLFKAFGRTLRQAIRVEGD---TLPSSKGVL")
06381         self.assertEqual(record.rounds[0].alignments[7].hsps[0].query_start, 3)
06382         self.assertEqual(record.rounds[0].alignments[7].hsps[0].query_end, 200)
06383         self.assertEqual(record.rounds[0].alignments[7].hsps[0].sbjct_start, 167)
06384         self.assertEqual(record.rounds[0].alignments[7].hsps[0].sbjct_end, 355)
06385         self.assertEqual(record.rounds[0].alignments[8].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06386         self.assertEqual(record.rounds[0].alignments[8].hsps[0].match, "R + + R TKET + +S+NL G+G   ++TG+ FLDHML  +  H   DL++   GD E   +D HH  EDV I LG+ ++E LG++ GI R+G F  P+DEALV   LD SGRP+L +   +   +++G YDT++  EFF A+  ++ +TLH+ +  G N+HHIIE  FK+ ARA++ A+ +D  +   IPSSKGVL")
06387         self.assertEqual(record.rounds[0].alignments[8].hsps[0].sbjct, "RAAAVHRVTKETDVRVSLNLMGSGLCHVATGVPFLDHMLHQIASHGLIDLEVNATGDIE---IDDHHTNEDVGITLGQALAEALGDRRGINRFGHFIAPLDEALVQVTLDFSGRPHLSYGLQIP-TERVGTYDTQLVREFFVAVVNHSQMTLHIRQLDGINSHHIIEATFKAFARAMRMAIEVDPRRADTIPSSKGVL")
06388         self.assertEqual(record.rounds[0].alignments[8].hsps[0].query_start, 3)
06389         self.assertEqual(record.rounds[0].alignments[8].hsps[0].query_end, 200)
06390         self.assertEqual(record.rounds[0].alignments[8].hsps[0].sbjct_start, 17)
06391         self.assertEqual(record.rounds[0].alignments[8].hsps[0].sbjct_end, 210)
06392         self.assertEqual(record.rounds[0].alignments[9].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06393         self.assertEqual(record.rounds[0].alignments[9].hsps[0].match, "R + + R TKET I++ + LD  G  +I TG+GF DHML  +  H  F + +   GD   + +D HH +ED A+ALG+ + + +G+K GI R+G F +PMDE    C LD+SGRP++ F+A      K+G + TE+TE FF++LAF+   TLHLN   G N HH IE +FK+  R L+QA+ I+ +   E+PSSKGVL")
06394         self.assertEqual(record.rounds[0].alignments[9].hsps[0].sbjct, "RFAEVIRQTKETDIKVQVWLDEAGVNEIKTGVGFFDHMLDQIATHGGFRMNVQCKGD---LWIDEHHTVEDTALALGQALKQAVGDKRGIARFG-FVLPMDECKAECALDLSGRPWIKFNACFK-RDKVGDFSTELTEHFFQSLAFSMLATLHLNV-TGNNDHHKIESLFKAFGRTLRQAIRIEGN---EMPSSKGVL")
06395         self.assertEqual(record.rounds[0].alignments[9].hsps[0].query_start, 3)
06396         self.assertEqual(record.rounds[0].alignments[9].hsps[0].query_end, 200)
06397         self.assertEqual(record.rounds[0].alignments[9].hsps[0].sbjct_start, 174)
06398         self.assertEqual(record.rounds[0].alignments[9].hsps[0].sbjct_end, 362)
06399         self.assertEqual(record.rounds[0].alignments[10].hsps[0].query, "TRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVF--------HADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06400         self.assertEqual(record.rounds[0].alignments[10].hsps[0].match, "+R + I R T+E+ I + ++LDGTGQ  + TG+ F DHMLT L  H+ FDL +   GD E   ++ HH IED AIALG  + + LG+K GIRR+G   IPMDE L    +D+SGRPY V         H  ++G+     Y T +    F +LA NA I LH+   YG++ HHI E  +K+ ARAL+QAV  D  +V  +PS+KG L")
06401         self.assertEqual(record.rounds[0].alignments[10].hsps[0].sbjct, "SRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVE---IEAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSV--PYHTVINRHVFESLAANARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPD-PRVSGVPSTKGAL")
06402         self.assertEqual(record.rounds[0].alignments[10].hsps[0].query_start, 2)
06403         self.assertEqual(record.rounds[0].alignments[10].hsps[0].query_end, 200)
06404         self.assertEqual(record.rounds[0].alignments[10].hsps[0].sbjct_start, 10)
06405         self.assertEqual(record.rounds[0].alignments[10].hsps[0].sbjct_end, 210)
06406         self.assertEqual(record.rounds[0].alignments[11].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06407         self.assertEqual(record.rounds[0].alignments[11].hsps[0].match, "R +H+ RNTKETQI++S+ LD  G + I+TG+GF DHML  +  H  F ++I   GD   + +D HH +ED  +AL + +   L +K GI R+G F +PMDE L  C LDISGRP+L + A+ +  Q++G   TEM E FFR+L++  G+TLHL    G+N HH +E +FK+  R ++QA+ ++      +PSSKGVL")
06408         self.assertEqual(record.rounds[0].alignments[11].hsps[0].sbjct, "RYAHVVRNTKETQIDVSVWLDREGNSKINTGVGFFDHMLDQIATHGGFRMEITVKGD---LYIDDHHTVEDTGLALREALKLALRDKRGICRFG-FVLPMDECL-ACALDISGRPHLEYKAEFT-YQRVGNLSTEMIEHFFRSLSYTMGVTLHLKTK-GKNDHHRVESLFKAFGRTVRQAIRVEGD---TLPSSKGVL")
06409         self.assertEqual(record.rounds[0].alignments[11].hsps[0].query_start, 3)
06410         self.assertEqual(record.rounds[0].alignments[11].hsps[0].query_end, 200)
06411         self.assertEqual(record.rounds[0].alignments[11].hsps[0].sbjct_start, 167)
06412         self.assertEqual(record.rounds[0].alignments[11].hsps[0].sbjct_end, 354)
06413         self.assertEqual(record.rounds[0].alignments[12].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06414         self.assertEqual(record.rounds[0].alignments[12].hsps[0].match, "R S  TR T ET +++ + +DG+G++ ++TG+GFLDHML  +  H   DL++   GD E   +D HH +EDVA+ LG+ + E LG+K GIRR     +PMD+AL T  LD+SGRPY V   +   +  +G   ++    F  +LA +A + +H +   G+N HH  E +FK+ A A++ AV ++    GEIPS+KG L")
06415         self.assertEqual(record.rounds[0].alignments[12].hsps[0].sbjct, "RRSMKTRETLETHVKVDLEIDGSGKSSVNTGLGFLDHMLESVARHGLLDLEVEARGDLE---VDDHHTVEDVALTLGEALREALGDKSGIRRMAHAMVPMDDALATVALDLSGRPYTVLELEFD-DAVIGDVKSQNIGHFIESLAVSAAMNIHASVR-GRNDHHKAEALFKALALAIRDAVRVEH---GEIPSTKGKL")
06416         self.assertEqual(record.rounds[0].alignments[12].hsps[0].query_start, 3)
06417         self.assertEqual(record.rounds[0].alignments[12].hsps[0].query_end, 200)
06418         self.assertEqual(record.rounds[0].alignments[12].hsps[0].sbjct_start, 5)
06419         self.assertEqual(record.rounds[0].alignments[12].hsps[0].sbjct_end, 194)
06420         self.assertEqual(record.rounds[0].alignments[13].hsps[0].query, "RISHITRNTKETQIELSINLDGTG-----QADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06421         self.assertEqual(record.rounds[0].alignments[13].hsps[0].match, "RI+ + R T ET I  +I+LD        + ++STGIGFLDHM T L  H    L++   GD   + +D HH  ED A+ALG+   + LG + GI+RYG    P+DE+L    +DIS RPY + H   +  +K+G   TEM     ++ AF AG+TLH++   G+N HHI E  FK+ A A++ A+S   +   ++PS+KGVL")
06422         self.assertEqual(record.rounds[0].alignments[13].hsps[0].sbjct, "RIASVERTTSETHISCTIDLDHIPGVTEQKINVSTGIGFLDHMFTALAKHGGMSLQLQCKGD---LHIDDHHTAEDCALALGEAFKKALGERKGIKRYGYAYAPLDESLSRAVIDISSRPYFMCHLPFT-REKVGDLSTEMVSHLLQSFAFAAGVTLHIDSIRGENNHHIAESAFKALALAIRMAIS--RTGGDDVPSTKGVL")
06423         self.assertEqual(record.rounds[0].alignments[13].hsps[0].query_start, 3)
06424         self.assertEqual(record.rounds[0].alignments[13].hsps[0].query_end, 200)
06425         self.assertEqual(record.rounds[0].alignments[13].hsps[0].sbjct_start, 4)
06426         self.assertEqual(record.rounds[0].alignments[13].hsps[0].sbjct_end, 200)
06427         self.assertEqual(record.rounds[0].alignments[14].hsps[0].query, "MTRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHML-TLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06428         self.assertEqual(record.rounds[0].alignments[14].hsps[0].match, "M+R ++ITR TKET+IE+ +++D  G+  +ST I F +HML TLLT+ +     I+   D   +  D HH++EDVAI LG  I   LG+K GI+R+    IPMD+ALV   LDIS R     + +L  ++ +GG  TE    FF++ A+N+GITLH+++  G NTHHIIE  FK+   AL +A  I ++   EI S+KG++")
06429         self.assertEqual(record.rounds[0].alignments[14].hsps[0].sbjct, "MSRSANITRETKETKIEVLLDIDRKGEVKVSTPIPFFNHMLITLLTYMNS--TAIVSATDK--LPYDDHHIVEDVAITLGLAIKTALGDKRGIKRFSHQIIPMDDALVLVSLDISNRGMAFVNLNLKRSE-IGGLATENVPHFFQSFAYNSGITLHISQLSGYNTHHIIEASFKALGLALYEATRIVDN---EIRSTKGII")
06430         self.assertEqual(record.rounds[0].alignments[14].hsps[0].query_start, 1)
06431         self.assertEqual(record.rounds[0].alignments[14].hsps[0].query_end, 200)
06432         self.assertEqual(record.rounds[0].alignments[14].hsps[0].sbjct_start, 1)
06433         self.assertEqual(record.rounds[0].alignments[14].hsps[0].sbjct_end, 193)
06434         self.assertEqual(record.rounds[0].alignments[15].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06435         self.assertEqual(record.rounds[0].alignments[15].hsps[0].match, "R ++I+R TKET I + ++LDGTG++ +S+GIGFLDHMLT L  HS FDL++   GD     +D HH  ED A+ LG+     LG++ GI R+GS  +P+DEAL    +DIS R +   +  L     +G   +EM   FF + A  A  TLH++   G+N HH  E  FK+ A AL+ AV  D +    +PS+KGVL")
06436         self.assertEqual(record.rounds[0].alignments[15].hsps[0].sbjct, "REANISRVTKETSISVKLSLDGTGKSKVSSGIGFLDHMLTALAKHSRFDLELDCKGD---TWIDDHHTTEDCALTLGEAFDVALGDRAGIARFGSACVPLDEALSRAIVDISSRAHSEINLQLV-RPSVGELSSEMITHFFESFASAALXTLHVDVLRGRNDHHRAEASFKALAVALRTAVKHDAT--AGVPSTKGVL")
06437         self.assertEqual(record.rounds[0].alignments[15].hsps[0].query_start, 3)
06438         self.assertEqual(record.rounds[0].alignments[15].hsps[0].query_end, 200)
06439         self.assertEqual(record.rounds[0].alignments[15].hsps[0].sbjct_start, 260)
06440         self.assertEqual(record.rounds[0].alignments[15].hsps[0].sbjct_end, 451)
06441         self.assertEqual(record.rounds[0].alignments[16].hsps[0].query, "RISHITRNTKETQIELSINLD-----------------------GTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06442         self.assertEqual(record.rounds[0].alignments[16].hsps[0].match, "R + + RNT ET+I ++I LD                       G     + TGIGFLDHM   L  H+ + L++   GD   + +D HH  ED AIALG    + +GN  G++R+G    P+DEAL    +D+SGRPY V    L   +K+G    EM      + +  AGITLH+   YG N HH  E  FKS A A++ A S+  S   E+PS+KGVL")
06443         self.assertEqual(record.rounds[0].alignments[16].hsps[0].sbjct, "RRAFVERNTNETKISVAIALDKAPLPEESNFIDELITSKHANQKGEQVIQVDTGIGFLDHMYHALAKHAGWSLRLYSRGD---LIIDDHHTAEDTAIALGIAFKQAMGNFAGVKRFGHAYCPLDEALSRSVVDLSGRPYAVIDLGLK-REKVGELSCEMIPHLLYSFSVAAGITLHVTCLYGSNDHHRAESAFKSLAVAMRAATSLTGS--SEVPSTKGVL")
06444         self.assertEqual(record.rounds[0].alignments[16].hsps[0].query_start, 3)
06445         self.assertEqual(record.rounds[0].alignments[16].hsps[0].query_end, 200)
06446         self.assertEqual(record.rounds[0].alignments[16].hsps[0].sbjct_start, 2)
06447         self.assertEqual(record.rounds[0].alignments[16].hsps[0].sbjct_end, 216)
06448         self.assertEqual(record.rounds[0].alignments[17].hsps[0].query, "MTRISHITRNTKETQIELSINLDG---------------------------TGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06449         self.assertEqual(record.rounds[0].alignments[17].hsps[0].match, "M+R + I R T ET+I++++NLDG                           +   ++ TGIGFLDHM+  L  HS + L +   GD   + +D HH  EDV I+LG    + LG   G++R+G    P+DEAL    +D+S RP+ V    L   +K+G   TEM      + A   GIT+H++   G N HH  E  FK+ A A+K+A+S  ++   +IPS+KGVL")
06450         self.assertEqual(record.rounds[0].alignments[17].hsps[0].sbjct, "MSREALINRITNETKIQIALNLDGGKLELKESIFPNQSIIIDEHHAKQVSGSQYINVQTGIGFLDHMIHALAKHSGWSLIVECIGD---LHIDDHHTAEDVGISLGMAFKQALGQIKGVKRFGHGFAPLDEALSRAVVDLSNRPFAVIELGLK-REKIGDLSTEMIPHVLESFAGAVGITIHVDCLRGFNDHHRAESAFKALAIAIKEAIS--KTGKNDIPSTKGVL")
06451         self.assertEqual(record.rounds[0].alignments[17].hsps[0].query_start, 1)
06452         self.assertEqual(record.rounds[0].alignments[17].hsps[0].query_end, 200)
06453         self.assertEqual(record.rounds[0].alignments[17].hsps[0].sbjct_start, 1)
06454         self.assertEqual(record.rounds[0].alignments[17].hsps[0].sbjct_end, 221)
06455         self.assertEqual(record.rounds[0].alignments[18].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKG")
06456         self.assertEqual(record.rounds[0].alignments[18].hsps[0].match, "RI  + R TKET I L IN+DGTG+  I TGI F DH+L     H  FDL +   GD E   +D HH +EDV I LG  +++    K  I R+G   IPMD+A  T  +D+SGR Y V + +    + +G   TE    FF ++A    + +H  E  G+N HH  E +FK+   AL  A  IDE K   + S+KG")
06457         self.assertEqual(record.rounds[0].alignments[18].hsps[0].sbjct, "RIFEVMRETKETNIYLKINIDGTGKYKIDTGIPFFDHLLASFAKHGCFDLIVKARGDLE---IDDHHTVEDVGICLGLALNQI--EKRNIFRFGWAIIPMDDARATVAIDLSGRSYCVGNYE-PKREFVGDLATENINHFFESVASYGMLNIHY-EVIGKNEHHKAEALFKAFGVALDLATKIDERK--GVISTKG")
06458         self.assertEqual(record.rounds[0].alignments[18].hsps[0].query_start, 3)
06459         self.assertEqual(record.rounds[0].alignments[18].hsps[0].query_end, 198)
06460         self.assertEqual(record.rounds[0].alignments[18].hsps[0].sbjct_start, 7)
06461         self.assertEqual(record.rounds[0].alignments[18].hsps[0].sbjct_end, 193)
06462         self.assertEqual(record.rounds[0].alignments[19].hsps[0].query, "RISHITRNTKETQIELSINLDG-------------------TGQA------DISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06463         self.assertEqual(record.rounds[0].alignments[19].hsps[0].match, "R S I R T ET+I+++++LDG                     QA       ++TGIGFLDHML  L  H  + + I   GD   + +D HH  ED  IALG    E LG+  GI+R+GS   P+DEAL    +D+S RPY V    L   +K+G    EM      + A  A +T+H++   G N HH  E  FK+ A A+K+A+S   +   +IPS+KGVL")
06464         self.assertEqual(record.rounds[0].alignments[19].hsps[0].sbjct, "RSSLIKRITNETKIQIALSLDGGPVSLAQSLFKDKDYSAEHAAQATSSQFISVNTGIGFLDHMLHALAKHGGWSVIIECVGD---LHIDDHHSAEDTGIALGMAFKEALGHVRGIKRFGSGFAPLDEALSRAVIDMSNRPYAVVDLGLK-REKIGDLSCEMIPHVLESFAQGAHVTMHVDCLRGFNDHHRAESAFKALAIAIKEAIS--SNGTDDIPSTKGVL")
06465         self.assertEqual(record.rounds[0].alignments[19].hsps[0].query_start, 3)
06466         self.assertEqual(record.rounds[0].alignments[19].hsps[0].query_end, 200)
06467         self.assertEqual(record.rounds[0].alignments[19].hsps[0].sbjct_start, 7)
06468         self.assertEqual(record.rounds[0].alignments[19].hsps[0].sbjct_end, 223)
06469         self.assertEqual(record.rounds[0].alignments[20].hsps[0].query, "RISHITRNTKETQIELSINLDG------------------TGQA------DISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06470         self.assertEqual(record.rounds[0].alignments[20].hsps[0].match, "R + I+R T ET+I+++I+L+G                    QA      DI TG+GFLDHM+  L  HS + L +   GD   + +D HH  ED  IALG+   E +G   G++R+G+   P+DEAL    +D+S RP+ V    L   + +G   TEM   F  + A  A ITLH++   G N HH  E  FK+ A A+++A+S   +   ++PS+KGVL")
06471         self.assertEqual(record.rounds[0].alignments[20].hsps[0].sbjct, "RKAFISRITNETKIQIAISLNGGYIQIKDSILPAKKDDDVASQATQSQVIDIHTGVGFLDHMIHALAKHSGWSLIVECIGD---LHIDDHHTTEDCGIALGQAFKEAMGAVRGVKRFGTGFAPLDEALSRAVVDLSNRPFAVIDLGLK-REMIGDLSTEMIPHFLESFAEAARITLHVDCLRGFNDHHRSESAFKALAVAIREAIS--SNGTNDVPSTKGVL")
06472         self.assertEqual(record.rounds[0].alignments[20].hsps[0].query_start, 3)
06473         self.assertEqual(record.rounds[0].alignments[20].hsps[0].query_end, 200)
06474         self.assertEqual(record.rounds[0].alignments[20].hsps[0].sbjct_start, 16)
06475         self.assertEqual(record.rounds[0].alignments[20].hsps[0].sbjct_end, 231)
06476         self.assertEqual(record.rounds[0].alignments[21].hsps[0].query, "ISHITRNTKETQIELSINLDG-----------------TGQA-DISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06477         self.assertEqual(record.rounds[0].alignments[21].hsps[0].match, "++ + R T+ET I+L+++LDG                  GQ   + TG+GFLDHMLT L  H  + L +   GD   + +D HH +ED  IALG+   E LG+  GI+R+G    P+DEAL    +D S RP+ V    L   +++G   TEM   F  + A    IT+H++   G N HH  E  FK+ A A+++A +   +   ++PS+KGVL")
06478         self.assertEqual(record.rounds[0].alignments[21].hsps[0].sbjct, "MAFVKRVTQETNIQLALDLDGGSVSVRESILGKEYASGDGQTIHVHTGVGFLDHMLTALAKHGGWSLILECIGD---LHIDDHHTVEDCGIALGQAFKEALGSVRGIKRFGHGFAPLDEALSRAVVDFSNRPFAVVELGLK-RERIGQLSTEMIPHFLESFATEGRITMHVDCLRGTNDHHRSESGFKALAIAIREART--PTGRDDVPSTKGVL")
06479         self.assertEqual(record.rounds[0].alignments[21].hsps[0].query_start, 4)
06480         self.assertEqual(record.rounds[0].alignments[21].hsps[0].query_end, 200)
06481         self.assertEqual(record.rounds[0].alignments[21].hsps[0].sbjct_start, 1)
06482         self.assertEqual(record.rounds[0].alignments[21].hsps[0].sbjct_end, 209)
06483         self.assertEqual(record.rounds[0].alignments[22].hsps[0].query, "ITRNTKETQIELSINLDGTGQA------------------------DISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06484         self.assertEqual(record.rounds[0].alignments[22].hsps[0].match, "+ R T ET+I+++I+L G   A                        ++ TGIGFLDHM+  L  HS + L +   GD   + +D HH  ED  IALG+   E LG   G++R+GS   P+DEAL    +D+S RPY V    L   +K+G    EM   F  + A  + ITLH++   G+N HH  E  FK+ A A+++A S   +   ++PS+KGVL")
06485         self.assertEqual(record.rounds[0].alignments[22].hsps[0].sbjct, "VKRITNETKIQIAISLKGGPLAIEHSIFPEKEAEAVAEQATQSQVINVHTGIGFLDHMIHALAKHSGWSLIVECIGD---LHIDDHHTTEDCGIALGQAFKEALGAVRGVKRFGSGFAPLDEALSRAVVDLSNRPYAVVELGLQ-REKVGDLSCEMIPHFLESFAEASRITLHVDCLRGKNDHHRSESAFKALAVAIREATS--PNGTNDVPSTKGVL")
06486         self.assertEqual(record.rounds[0].alignments[22].hsps[0].query_start, 7)
06487         self.assertEqual(record.rounds[0].alignments[22].hsps[0].query_end, 200)
06488         self.assertEqual(record.rounds[0].alignments[22].hsps[0].sbjct_start, 8)
06489         self.assertEqual(record.rounds[0].alignments[22].hsps[0].sbjct_end, 219)
06490         self.assertEqual(record.rounds[0].alignments[23].hsps[0].query, "RISHITRNTKETQIELSINLDG------------------------TGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALK")
06491         self.assertEqual(record.rounds[0].alignments[23].hsps[0].match, "R + ++R+T ET I++++++DG                        +    I+TGIGFLDHML  L  H+ + + +   GD   + +D HH  ED  IA+G   ++ LG   G+ R+G    P+DEAL    +D+S RPY V    L   +KLG    EM     ++ A  A ITLH++   G N HH  E  FK+ A A++")
06492         self.assertEqual(record.rounds[0].alignments[23].hsps[0].sbjct, "RAAALSRDTNETSIQIALSIDGGELPQDADPRLLEASSAHASQTSKSQVISINTGIGFLDHMLHALAKHAGWSMALNCKGD---LHIDDHHTAEDCCIAVGTTFAKALGALTGVARFGYAYAPLDEALSRAVVDLSNRPYTVVDLGLK-REKLGELSCEMIPHCLQSFAQAARITLHVDCLRGDNDHHRAESAFKALAVAVR")
06493         self.assertEqual(record.rounds[0].alignments[23].hsps[0].query_start, 3)
06494         self.assertEqual(record.rounds[0].alignments[23].hsps[0].query_end, 180)
06495         self.assertEqual(record.rounds[0].alignments[23].hsps[0].sbjct_start, 8)
06496         self.assertEqual(record.rounds[0].alignments[23].hsps[0].sbjct_end, 205)
06497         self.assertEqual(record.rounds[0].alignments[24].hsps[0].query, "GDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQK---LGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDES")
06498         self.assertEqual(record.rounds[0].alignments[24].hsps[0].match, "G+   +G  PH  + +++   G  +S  LG+   +      T+   + L T DL+   RPY+ + A ++ N K      YD     +++R +     + L+  +   Q+  HI E    S  R  KQA S +E+")
06499         self.assertEqual(record.rounds[0].alignments[24].hsps[0].sbjct, "GNLHQLGEKPHRAMVELSKTYGPLMSLKLGSVTTVVATSVETVR--DVLKTYDLECCSRPYMTYPARITYNLKDLVFSPYD-----KYWRQVRKLTVVELYTAKRV-QSFRHIREEEVASFVRFNKQAASSEET")
06500         self.assertEqual(record.rounds[0].alignments[24].hsps[0].query_start, 58)
06501         self.assertEqual(record.rounds[0].alignments[24].hsps[0].query_end, 188)
06502         self.assertEqual(record.rounds[0].alignments[24].hsps[0].sbjct_start, 40)
06503         self.assertEqual(record.rounds[0].alignments[24].hsps[0].sbjct_end, 165)
06504         self.assertEqual(record.rounds[0].alignments[25].hsps[0].query, "HSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLG")
06505         self.assertEqual(record.rounds[0].alignments[25].hsps[0].match, "HS+    I+G G H   G DPHH   D  +  G  +  D+G   G")
06506         self.assertEqual(record.rounds[0].alignments[25].hsps[0].sbjct, "HSEVAFVIVGSGPH---GADPHHGYSDRELREGDIVVVDIGGTYG")
06507         self.assertEqual(record.rounds[0].alignments[25].hsps[0].query_start, 47)
06508         self.assertEqual(record.rounds[0].alignments[25].hsps[0].query_end, 91)
06509         self.assertEqual(record.rounds[0].alignments[25].hsps[0].sbjct_start, 195)
06510         self.assertEqual(record.rounds[0].alignments[25].hsps[0].sbjct_end, 236)
06511         self.assertEqual(record.rounds[0].alignments[26].hsps[0].query, "PYLVF---HADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYG")
06512         self.assertEqual(record.rounds[0].alignments[26].hsps[0].match, "PYL+    H D+ GN +  G+  +M +E    L FN  I L  +  YG")
06513         self.assertEqual(record.rounds[0].alignments[26].hsps[0].sbjct, "PYLMLKGNHQDMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYG")
06514         self.assertEqual(record.rounds[0].alignments[26].hsps[0].query_start, 117)
06515         self.assertEqual(record.rounds[0].alignments[26].hsps[0].query_end, 161)
06516         self.assertEqual(record.rounds[0].alignments[26].hsps[0].sbjct_start, 427)
06517         self.assertEqual(record.rounds[0].alignments[26].hsps[0].sbjct_end, 474)
06518         self.assertEqual(record.rounds[0].alignments[27].hsps[0].query, "GKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLG---GYDTEMTEEFFRA")
06519         self.assertEqual(record.rounds[0].alignments[27].hsps[0].match, "GK ISED     GI + G     +D   VT + D  G    +  + L  N++ G    YD E T EF RA")
06520         self.assertEqual(record.rounds[0].alignments[27].hsps[0].sbjct, "GKEISEDKWEDFGISQRGEEKFFIDAEKVTVEFD--GFQAKIQMSSLYKNKQCGLCGHYDGEKTNEFRRA")
06521         self.assertEqual(record.rounds[0].alignments[27].hsps[0].query_start, 79)
06522         self.assertEqual(record.rounds[0].alignments[27].hsps[0].query_end, 145)
06523         self.assertEqual(record.rounds[0].alignments[27].hsps[0].sbjct_start, 1436)
06524         self.assertEqual(record.rounds[0].alignments[27].hsps[0].sbjct_end, 1503)
06525         self.assertEqual(record.rounds[0].alignments[28].hsps[0].query, "RYGSFTIPMDEAL-----VTCDLDISGRPYLVFHADLSGNQKL--GGYDTEMTEEFFRALAFNAG")
06526         self.assertEqual(record.rounds[0].alignments[28].hsps[0].match, "R GS ++P++E          D DI G  Y   H D+  NQ+L  G  D  +++   +   FN+G")
06527         self.assertEqual(record.rounds[0].alignments[28].hsps[0].sbjct, "RNGSNSLPLNEKSNEGESTNVDQDIEGDEYHRLHEDILKNQELDDGSLDDLLSQIIPKITNFNSG")
06528         self.assertEqual(record.rounds[0].alignments[28].hsps[0].query_start, 94)
06529         self.assertEqual(record.rounds[0].alignments[28].hsps[0].query_end, 151)
06530         self.assertEqual(record.rounds[0].alignments[28].hsps[0].sbjct_start, 1141)
06531         self.assertEqual(record.rounds[0].alignments[28].hsps[0].sbjct_end, 1205)
06532         self.assertEqual(record.rounds[0].alignments[29].hsps[0].query, "PYLVF---HADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYG")
06533         self.assertEqual(record.rounds[0].alignments[29].hsps[0].match, "PYL+    H ++ GN +  G+  +M +E    L FN  I L  +  YG")
06534         self.assertEqual(record.rounds[0].alignments[29].hsps[0].sbjct, "PYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYG")
06535         self.assertEqual(record.rounds[0].alignments[29].hsps[0].query_start, 117)
06536         self.assertEqual(record.rounds[0].alignments[29].hsps[0].query_end, 161)
06537         self.assertEqual(record.rounds[0].alignments[29].hsps[0].sbjct_start, 427)
06538         self.assertEqual(record.rounds[0].alignments[29].hsps[0].sbjct_end, 474)
06539         self.assertEqual(record.rounds[1].alignments[0].hsps[0].query, "TRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06540         self.assertEqual(record.rounds[1].alignments[0].hsps[0].match, "TR+  + R TKET + + INLDG+G AD STGI FLDHML  L  H  FD+ +   GD   V +D HH  EDVA+A+G  + + LG++ GI R+G F+ P+DEAL+   LD+SGRP+L ++ D+   Q++G YDT++ E F +++   +G+TLH+ +  G+N+HHIIE  FK+ ARAL+QA   D  + G +PSSKGVL")
06541         self.assertEqual(record.rounds[1].alignments[0].hsps[0].sbjct, "TRVGEVKRVTKETNVSVKINLDGSGVADSSTGIPFLDHMLDQLASHGLFDVHVKATGD---VHIDDHHTNEDVALAIGTALLQALGDRKGINRFGDFSAPLDEALIHVSLDLSGRPHLSYNLDIP-TQRVGTYDTQVVEHFLQSIVNTSGMTLHIRQLAGRNSHHIIEATFKAFARALRQATEYDPRRRGSVPSSKGVL")
06542         self.assertEqual(record.rounds[1].alignments[0].hsps[0].query_start, 2)
06543         self.assertEqual(record.rounds[1].alignments[0].hsps[0].query_end, 200)
06544         self.assertEqual(record.rounds[1].alignments[0].hsps[0].sbjct_start, 84)
06545         self.assertEqual(record.rounds[1].alignments[0].hsps[0].sbjct_end, 278)
06546         self.assertEqual(record.rounds[1].alignments[1].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06547         self.assertEqual(record.rounds[1].alignments[1].hsps[0].match, "RI  + R TKET + + INLDGTG AD S+GI FLDHML  L  H  FD+ +   GD   V +D HH  ED+A+A+G  + + LG + GI R+G FT P+DEAL+   LD+SGRPYL ++ ++   Q++G YDT++ E FF++L   +G+TLH+ +  G+N+HHIIE  FK+ ARAL+QA   D  + G IPSSKGVL")
06548         self.assertEqual(record.rounds[1].alignments[1].hsps[0].sbjct, "RIGEVKRVTKETNVSVKINLDGTGVADSSSGIPFLDHMLDQLASHGLFDVHVRATGD---VHIDDHHTNEDIALAIGTALLKALGERKGINRFGDFTAPLDEALIHVSLDLSGRPYLGYNLEIP-TQRVGTYDTQLVEHFFQSLVNTSGMTLHIRQLAGENSHHIIEATFKAFARALRQATETDPRRGGTIPSSKGVL")
06549         self.assertEqual(record.rounds[1].alignments[1].hsps[0].query_start, 3)
06550         self.assertEqual(record.rounds[1].alignments[1].hsps[0].query_end, 200)
06551         self.assertEqual(record.rounds[1].alignments[1].hsps[0].sbjct_start, 74)
06552         self.assertEqual(record.rounds[1].alignments[1].hsps[0].sbjct_end, 267)
06553         self.assertEqual(record.rounds[1].alignments[2].hsps[0].query, "MTRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06554         self.assertEqual(record.rounds[1].alignments[2].hsps[0].match, "MTRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06555         self.assertEqual(record.rounds[1].alignments[2].hsps[0].sbjct, "MTRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06556         self.assertEqual(record.rounds[1].alignments[2].hsps[0].query_start, 1)
06557         self.assertEqual(record.rounds[1].alignments[2].hsps[0].query_end, 200)
06558         self.assertEqual(record.rounds[1].alignments[2].hsps[0].sbjct_start, 1)
06559         self.assertEqual(record.rounds[1].alignments[2].hsps[0].sbjct_end, 200)
06560         self.assertEqual(record.rounds[1].alignments[3].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06561         self.assertEqual(record.rounds[1].alignments[3].hsps[0].match, "R + + R TKET + +S+NL G+G   ++TG+ FLDHML  +  H   DL++   GD E   +D HH  EDV I LG+ ++E LG++ GI R+G F  P+DEALV   LD SGRP+L +   +   +++G YDT++  EFF A+  ++ +TLH+ +  G N+HHIIE  FK+ ARA++ A+ +D  +   IPSSKGVL")
06562         self.assertEqual(record.rounds[1].alignments[3].hsps[0].sbjct, "RAAAVHRVTKETDVRVSLNLMGSGLCHVATGVPFLDHMLHQIASHGLIDLEVNATGDIE---IDDHHTNEDVGITLGQALAEALGDRRGINRFGHFIAPLDEALVQVTLDFSGRPHLSYGLQIP-TERVGTYDTQLVREFFVAVVNHSQMTLHIRQLDGINSHHIIEATFKAFARAMRMAIEVDPRRADTIPSSKGVL")
06563         self.assertEqual(record.rounds[1].alignments[3].hsps[0].query_start, 3)
06564         self.assertEqual(record.rounds[1].alignments[3].hsps[0].query_end, 200)
06565         self.assertEqual(record.rounds[1].alignments[3].hsps[0].sbjct_start, 17)
06566         self.assertEqual(record.rounds[1].alignments[3].hsps[0].sbjct_end, 210)
06567         self.assertEqual(record.rounds[1].alignments[4].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06568         self.assertEqual(record.rounds[1].alignments[4].hsps[0].match, "RI+ + R T ET +++++NLDGTG    +TGI FLDHML  ++ H   DL +   GD E   +D HH  EDV I LG+ +++ LG++ GI R+G+F  P+DEALV   LD SGRP+L +   +   +++G YDT++  EFF AL  ++ +TLH+ +  G N+HHIIE  FK+ ARA + A+ +D  + G IPSSKGVL")
06569         self.assertEqual(record.rounds[1].alignments[4].hsps[0].sbjct, "RIASVHRITGETNVQVTVNLDGTGICKAATGIPFLDHMLHQISSHGLIDLDVQAKGDWE---IDDHHTNEDVGITLGQALAKALGDRKGIVRFGNFLAPLDEALVQVALDFSGRPHLSYGLQIP-TERVGTYDTQLVREFFVALVNHSQMTLHIRQLDGINSHHIIEATFKAFARAARMAIEVDPRRAGTIPSSKGVL")
06570         self.assertEqual(record.rounds[1].alignments[4].hsps[0].query_start, 3)
06571         self.assertEqual(record.rounds[1].alignments[4].hsps[0].query_end, 200)
06572         self.assertEqual(record.rounds[1].alignments[4].hsps[0].sbjct_start, 16)
06573         self.assertEqual(record.rounds[1].alignments[4].hsps[0].sbjct_end, 209)
06574         self.assertEqual(record.rounds[1].alignments[5].hsps[0].query, "SHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06575         self.assertEqual(record.rounds[1].alignments[5].hsps[0].match, "  + R TKET + + INLDGTG A+ STGI FLDHML  L  H  FD+ +   GD     +D HH  ED+A+A+G  + + LG++ GI R+G FT P+DEA V   LD+SGRP+L     +   +++G YDT++ E FF++L   +G+TLH+ +  G N+HHIIE  FK+ ARAL+QA   D  + G +PSSKGVL")
06576         self.assertEqual(record.rounds[1].alignments[5].hsps[0].sbjct, "GEVKRVTKETNVHVKINLDGTGVANSSTGIPFLDHMLDQLASHGLFDVYVKATGDT---HIDDHHSNEDIALAIGTALLQALGDRKGINRFGHFTAPLDEAAVEVILDLSGRPHLSCGLSIP-TERVGTYDTQLVEHFFQSLVNTSGMTLHIRQLAGNNSHHIIEATFKAFARALRQATEYDLRRQGTMPSSKGVL")
06577         self.assertEqual(record.rounds[1].alignments[5].hsps[0].query_start, 5)
06578         self.assertEqual(record.rounds[1].alignments[5].hsps[0].query_end, 200)
06579         self.assertEqual(record.rounds[1].alignments[5].hsps[0].sbjct_start, 1)
06580         self.assertEqual(record.rounds[1].alignments[5].hsps[0].sbjct_end, 192)
06581         self.assertEqual(record.rounds[1].alignments[6].hsps[0].query, "MTRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06582         self.assertEqual(record.rounds[1].alignments[6].hsps[0].match, "M+R+  + R TKET + + I+LDGTG+ DI+TG+GF DHML  L  H  FDL +   GD   + +D HH IED A+ALG    + LG+K+GI R+G+ T+P+DE+L    +D+SGRPYLV     +    +G YD  MT     +    A + LH++  YG+N HHI+E  FK+ ARAL+ A   D    G +PS+KG L")
06583         self.assertEqual(record.rounds[1].alignments[6].hsps[0].sbjct, "MSRVGRVERTTKETSVLVEIDLDGTGKTDIATGVGFYDHMLDQLGRHGLFDLTVKTDGD---LHIDSHHTIEDTALALGAAFRQALGDKVGIYRFGNCTVPLDESLAQVTVDLSGRPYLVHTEPENMAPMIGEYDVTMTRHILESFVAQAQVALHVHVPYGRNAHHIVECQFKALARALRYASERDPRAAGILPSTKGAL")
06584         self.assertEqual(record.rounds[1].alignments[6].hsps[0].query_start, 1)
06585         self.assertEqual(record.rounds[1].alignments[6].hsps[0].query_end, 200)
06586         self.assertEqual(record.rounds[1].alignments[6].hsps[0].sbjct_start, 1)
06587         self.assertEqual(record.rounds[1].alignments[6].hsps[0].sbjct_end, 197)
06588         self.assertEqual(record.rounds[1].alignments[7].hsps[0].query, "SHITRNTKETQIELSINLDG------------------------TGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06589         self.assertEqual(record.rounds[1].alignments[7].hsps[0].match, "+ + R T ET+I+++I+L G                        +   ++ TGIGFLDHM+  L  HS + L +   GD   + +D HH  ED  IALG+   E LG   G++R+GS   P+DEAL    +D+S RPY V    L   +K+G    EM   F  + A  + ITLH++   G+N HH  E  FK+ A A+++A S   +   ++PS+KGVL")
06590         self.assertEqual(record.rounds[1].alignments[7].hsps[0].sbjct, "ALVKRITNETKIQIAISLKGGPLAIEHSIFPEKEAEAVAEQATQSQVINVHTGIGFLDHMIHALAKHSGWSLIVECIGD---LHIDDHHTTEDCGIALGQAFKEALGAVRGVKRFGSGFAPLDEALSRAVVDLSNRPYAVVELGL-QREKVGDLSCEMIPHFLESFAEASRITLHVDCLRGKNDHHRSESAFKALAVAIREATS--PNGTNDVPSTKGVL")
06591         self.assertEqual(record.rounds[1].alignments[7].hsps[0].query_start, 5)
06592         self.assertEqual(record.rounds[1].alignments[7].hsps[0].query_end, 200)
06593         self.assertEqual(record.rounds[1].alignments[7].hsps[0].sbjct_start, 6)
06594         self.assertEqual(record.rounds[1].alignments[7].hsps[0].sbjct_end, 219)
06595         self.assertEqual(record.rounds[1].alignments[8].hsps[0].query, "MTRISHITRNTKETQIELSINLDG---------------------------TGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06596         self.assertEqual(record.rounds[1].alignments[8].hsps[0].match, "M+R + I R T ET+I++++NLDG                           +   ++ TGIGFLDHM+  L  HS + L +   GD   + +D HH  EDV I+LG    + LG   G++R+G    P+DEAL    +D+S RP+ V    L   +K+G   TEM      + A   GIT+H++   G N HH  E  FK+ A A+K+A+S  ++   +IPS+KGVL")
06597         self.assertEqual(record.rounds[1].alignments[8].hsps[0].sbjct, "MSREALINRITNETKIQIALNLDGGKLELKESIFPNQSIIIDEHHAKQVSGSQYINVQTGIGFLDHMIHALAKHSGWSLIVECIGD---LHIDDHHTAEDVGISLGMAFKQALGQIKGVKRFGHGFAPLDEALSRAVVDLSNRPFAVIELGLK-REKIGDLSTEMIPHVLESFAGAVGITIHVDCLRGFNDHHRAESAFKALAIAIKEAIS--KTGKNDIPSTKGVL")
06598         self.assertEqual(record.rounds[1].alignments[8].hsps[0].query_start, 1)
06599         self.assertEqual(record.rounds[1].alignments[8].hsps[0].query_end, 200)
06600         self.assertEqual(record.rounds[1].alignments[8].hsps[0].sbjct_start, 1)
06601         self.assertEqual(record.rounds[1].alignments[8].hsps[0].sbjct_end, 221)
06602         self.assertEqual(record.rounds[1].alignments[9].hsps[0].query, "RISHITRNTKETQIELSINLDG------------------------TGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06603         self.assertEqual(record.rounds[1].alignments[9].hsps[0].match, "R + I+R T ET+I+++I+L+G                        +   DI TG+GFLDHM+  L  HS + L +   GD   + +D HH  ED  IALG+   E +G   G++R+G+   P+DEAL    +D+S RP+ V    L   + +G   TEM   F  + A  A ITLH++   G N HH  E  FK+ A A+++A+S   +   ++PS+KGVL")
06604         self.assertEqual(record.rounds[1].alignments[9].hsps[0].sbjct, "RKAFISRITNETKIQIAISLNGGYIQIKDSILPAKKDDDVASQATQSQVIDIHTGVGFLDHMIHALAKHSGWSLIVECIGD---LHIDDHHTTEDCGIALGQAFKEAMGAVRGVKRFGTGFAPLDEALSRAVVDLSNRPFAVIDLGLK-REMIGDLSTEMIPHFLESFAEAARITLHVDCLRGFNDHHRSESAFKALAVAIREAIS--SNGTNDVPSTKGVL")
06605         self.assertEqual(record.rounds[1].alignments[9].hsps[0].query_start, 3)
06606         self.assertEqual(record.rounds[1].alignments[9].hsps[0].query_end, 200)
06607         self.assertEqual(record.rounds[1].alignments[9].hsps[0].sbjct_start, 16)
06608         self.assertEqual(record.rounds[1].alignments[9].hsps[0].sbjct_end, 231)
06609         self.assertEqual(record.rounds[1].alignments[10].hsps[0].query, "SHITRNTKETQIELSINLDGTGQA------------------DISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06610         self.assertEqual(record.rounds[1].alignments[10].hsps[0].match, "+ + R T+ET I+L+++LDG   +                   + TG+GFLDHMLT L  H  + L +   GD   + +D HH +ED  IALG+   E LG+  GI+R+G    P+DEAL    +D S RP+ V    L   +++G   TEM   F  + A    IT+H++   G N HH  E  FK+ A A+++A     +   ++PS+KGVL")
06611         self.assertEqual(record.rounds[1].alignments[10].hsps[0].sbjct, "AFVKRVTQETNIQLALDLDGGSVSVRESILGKEYASGDGQTIHVHTGVGFLDHMLTALAKHGGWSLILECIGD---LHIDDHHTVEDCGIALGQAFKEALGSVRGIKRFGHGFAPLDEALSRAVVDFSNRPFAVVELGLK-RERIGQLSTEMIPHFLESFATEGRITMHVDCLRGTNDHHRSESGFKALAIAIREA--RTPTGRDDVPSTKGVL")
06612         self.assertEqual(record.rounds[1].alignments[10].hsps[0].query_start, 5)
06613         self.assertEqual(record.rounds[1].alignments[10].hsps[0].query_end, 200)
06614         self.assertEqual(record.rounds[1].alignments[10].hsps[0].sbjct_start, 2)
06615         self.assertEqual(record.rounds[1].alignments[10].hsps[0].sbjct_end, 209)
06616         self.assertEqual(record.rounds[1].alignments[11].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06617         self.assertEqual(record.rounds[1].alignments[11].hsps[0].match, "R +H+ RNTKETQI++ + LD  G + I+TG+GF DHML  +  H  F ++I   GD   + +D HH +ED  +ALG+ +   LG+K GI R+G F +PMDE L  C LDISGRP+L + A+ +  Q++G   TEM E FFR+L++  G+TLHL    G+N HH +E +FK+  R L+QA+ ++      +PSSKGVL")
06618         self.assertEqual(record.rounds[1].alignments[11].hsps[0].sbjct, "RYAHVVRNTKETQIDVQVWLDREGGSKINTGVGFFDHMLDQIATHGGFRMEINVKGD---LYIDDHHTVEDTGLALGEALKIALGDKRGICRFG-FVLPMDECLARCALDISGRPHLEYKAEFT-YQRVGDLSTEMIEHFFRSLSYTMGVTLHLKT-KGKNDHHRVESLFKAFGRTLRQAIRVEG---DTLPSSKGVL")
06619         self.assertEqual(record.rounds[1].alignments[11].hsps[0].query_start, 3)
06620         self.assertEqual(record.rounds[1].alignments[11].hsps[0].query_end, 200)
06621         self.assertEqual(record.rounds[1].alignments[11].hsps[0].sbjct_start, 167)
06622         self.assertEqual(record.rounds[1].alignments[11].hsps[0].sbjct_end, 355)
06623         self.assertEqual(record.rounds[1].alignments[12].hsps[0].query, "SHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06624         self.assertEqual(record.rounds[1].alignments[12].hsps[0].match, "+ I RNT ET+I +++NLDGTG  D+ TG+GFLDHML  L+ HS  DL +   GD   V +D HH  E   IA+G+ +++ +G++ GI+RYG   +PMDE L    LD S RPYL++    S   K+G  DTE+  E+F+A A  AG+TLH+   YG+N HHI+E  +K+ ARAL+  + ID  K   +PS+KG L")
06625         self.assertEqual(record.rounds[1].alignments[12].hsps[0].sbjct, "ASIERNTTETRIRVAVNLDGTGVYDVKTGVGFLDHMLEQLSRHSLMDLSVAAEGD---VHIDAHHTTEHSGIAIGQAVAKAVGDRKGIQRYGHAYVPMDETLTRVALDFSNRPYLIWKVSFS-RDKIGDMDTELFREWFQAFAMAAGVTLHVECLYGENNHHIVESCYKALARALRAGIEIDPRKRDAVPSTKGTL")
06626         self.assertEqual(record.rounds[1].alignments[12].hsps[0].query_start, 5)
06627         self.assertEqual(record.rounds[1].alignments[12].hsps[0].query_end, 200)
06628         self.assertEqual(record.rounds[1].alignments[12].hsps[0].sbjct_start, 12)
06629         self.assertEqual(record.rounds[1].alignments[12].hsps[0].sbjct_end, 203)
06630         self.assertEqual(record.rounds[1].alignments[13].hsps[0].query, "RISHITRNTKETQIELSINLDG-----TGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06631         self.assertEqual(record.rounds[1].alignments[13].hsps[0].match, "RI+ + R T ET I  +I+LD        + ++STGIGFLDHM T L  H    L++   GD   + +D HH  ED A+ALG+   + LG + GI+RYG    P+DE+L    +DIS RPY + H   +  +K+G   TEM     ++ AF AG+TLH++   G+N HHI E  FK+ A A++ A+S   +   ++PS+KGVL")
06632         self.assertEqual(record.rounds[1].alignments[13].hsps[0].sbjct, "RIASVERTTSETHISCTIDLDHIPGVTEQKINVSTGIGFLDHMFTALAKHGGMSLQLQCKGD---LHIDDHHTAEDCALALGEAFKKALGERKGIKRYGYAYAPLDESLSRAVIDISSRPYFMCHLPFT-REKVGDLSTEMVSHLLQSFAFAAGVTLHIDSIRGENNHHIAESAFKALALAIRMAIS--RTGGDDVPSTKGVL")
06633         self.assertEqual(record.rounds[1].alignments[13].hsps[0].query_start, 3)
06634         self.assertEqual(record.rounds[1].alignments[13].hsps[0].query_end, 200)
06635         self.assertEqual(record.rounds[1].alignments[13].hsps[0].sbjct_start, 4)
06636         self.assertEqual(record.rounds[1].alignments[13].hsps[0].sbjct_end, 200)
06637         self.assertEqual(record.rounds[1].alignments[14].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQA-------------------------DISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06638         self.assertEqual(record.rounds[1].alignments[14].hsps[0].match, "R S I R T ET+I+++++LDG   +                          ++TGIGFLDHML  L  H  + + I   GD   + +D HH  ED  IALG    E LG+  GI+R+GS   P+DEAL    +D+S RPY V    L   +K+G    EM      + A  A +T+H++   G N HH  E  FK+ A A+K+A+S   +   +IPS+KGVL")
06639         self.assertEqual(record.rounds[1].alignments[14].hsps[0].sbjct, "RSSLIKRITNETKIQIALSLDGGPVSLAQSLFKDKDYSAEHAAQATSSQFISVNTGIGFLDHMLHALAKHGGWSVIIECVGD---LHIDDHHSAEDTGIALGMAFKEALGHVRGIKRFGSGFAPLDEALSRAVIDMSNRPYAVVDLGLK-REKIGDLSCEMIPHVLESFAQGAHVTMHVDCLRGFNDHHRAESAFKALAIAIKEAIS--SNGTDDIPSTKGVL")
06640         self.assertEqual(record.rounds[1].alignments[14].hsps[0].query_start, 3)
06641         self.assertEqual(record.rounds[1].alignments[14].hsps[0].query_end, 200)
06642         self.assertEqual(record.rounds[1].alignments[14].hsps[0].sbjct_start, 7)
06643         self.assertEqual(record.rounds[1].alignments[14].hsps[0].sbjct_end, 223)
06644         self.assertEqual(record.rounds[1].alignments[15].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06645         self.assertEqual(record.rounds[1].alignments[15].hsps[0].match, "R + + R TKET I++ + LD  G  +I TG+GF DHML  +  H  F + +   GD   + +D HH +ED A+ALG+ + + +G+K GI R+G F +PMDE    C LD+SGRP++ F+A      K+G + TE+TE FF++LAF+   TLHLN   G N HH IE +FK+  R L+QA+ I+ +   E+PSSKGVL")
06646         self.assertEqual(record.rounds[1].alignments[15].hsps[0].sbjct, "RFAEVIRQTKETDIKVQVWLDEAGVNEIKTGVGFFDHMLDQIATHGGFRMNVQCKGD---LWIDEHHTVEDTALALGQALKQAVGDKRGIARFG-FVLPMDECKAECALDLSGRPWIKFNACFK-RDKVGDFSTELTEHFFQSLAFSMLATLHLNV-TGNNDHHKIESLFKAFGRTLRQAIRIEGN---EMPSSKGVL")
06647         self.assertEqual(record.rounds[1].alignments[15].hsps[0].query_start, 3)
06648         self.assertEqual(record.rounds[1].alignments[15].hsps[0].query_end, 200)
06649         self.assertEqual(record.rounds[1].alignments[15].hsps[0].sbjct_start, 174)
06650         self.assertEqual(record.rounds[1].alignments[15].hsps[0].sbjct_end, 362)
06651         self.assertEqual(record.rounds[1].alignments[16].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGI-TLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06652         self.assertEqual(record.rounds[1].alignments[16].hsps[0].match, "R ++I+R TKET I + ++LDGTG++ +S+GIGFLDHMLT L  HS FDL++   GD     +D HH  ED A+ LG+     LG++ GI R+GS  +P+DEAL    +DIS R +   +  L     +G   +EM   FF + A  A + TLH++   G+N HH  E  FK+ A AL+ AV  D +    +PS+KGVL")
06653         self.assertEqual(record.rounds[1].alignments[16].hsps[0].sbjct, "REANISRVTKETSISVKLSLDGTGKSKVSSGIGFLDHMLTALAKHSRFDLELDCKGDT---WIDDHHTTEDCALTLGEAFDVALGDRAGIARFGSACVPLDEALSRAIVDISSRAHSEINLQLV-RPSVGELSSEMITHFFESFASAA-LXTLHVDVLRGRNDHHRAEASFKALAVALRTAVKHDAT--AGVPSTKGVL")
06654         self.assertEqual(record.rounds[1].alignments[16].hsps[0].query_start, 3)
06655         self.assertEqual(record.rounds[1].alignments[16].hsps[0].query_end, 200)
06656         self.assertEqual(record.rounds[1].alignments[16].hsps[0].sbjct_start, 260)
06657         self.assertEqual(record.rounds[1].alignments[16].hsps[0].sbjct_end, 451)
06658         self.assertEqual(record.rounds[1].alignments[17].hsps[0].query, "RISHITRNTKETQIELSINLD-----------------------GTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06659         self.assertEqual(record.rounds[1].alignments[17].hsps[0].match, "R + + RNT ET+I ++I LD                       G     + TGIGFLDHM   L  H+ + L++   GD   + +D HH  ED AIALG    + +GN  G++R+G    P+DEAL    +D+SGRPY V    L   +K+G    EM      + +  AGITLH+   YG N HH  E  FKS A A++ A S+  +   E+PS+KGVL")
06660         self.assertEqual(record.rounds[1].alignments[17].hsps[0].sbjct, "RRAFVERNTNETKISVAIALDKAPLPEESNFIDELITSKHANQKGEQVIQVDTGIGFLDHMYHALAKHAGWSLRLYSRGD---LIIDDHHTAEDTAIALGIAFKQAMGNFAGVKRFGHAYCPLDEALSRSVVDLSGRPYAVIDLGLK-REKVGELSCEMIPHLLYSFSVAAGITLHVTCLYGSNDHHRAESAFKSLAVAMRAATSL--TGSSEVPSTKGVL")
06661         self.assertEqual(record.rounds[1].alignments[17].hsps[0].query_start, 3)
06662         self.assertEqual(record.rounds[1].alignments[17].hsps[0].query_end, 200)
06663         self.assertEqual(record.rounds[1].alignments[17].hsps[0].sbjct_start, 2)
06664         self.assertEqual(record.rounds[1].alignments[17].hsps[0].sbjct_end, 216)
06665         self.assertEqual(record.rounds[1].alignments[18].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06666         self.assertEqual(record.rounds[1].alignments[18].hsps[0].match, "R +H+ RNTKETQI++S+ LD  G + I+TG+GF DHML  +  H  F ++I   GD   + +D HH +ED  +AL + +   L +K GI R+G F +PMDE L  C LDISGRP+L + A+ +  Q++G   TEM E FFR+L++  G+TLHL    G+N HH +E +FK+  R ++QA+ ++      +PSSKGVL")
06667         self.assertEqual(record.rounds[1].alignments[18].hsps[0].sbjct, "RYAHVVRNTKETQIDVSVWLDREGNSKINTGVGFFDHMLDQIATHGGFRMEITVKGD---LYIDDHHTVEDTGLALREALKLALRDKRGICRFG-FVLPMDECLA-CALDISGRPHLEYKAEFT-YQRVGNLSTEMIEHFFRSLSYTMGVTLHLKT-KGKNDHHRVESLFKAFGRTVRQAIRVEG---DTLPSSKGVL")
06668         self.assertEqual(record.rounds[1].alignments[18].hsps[0].query_start, 3)
06669         self.assertEqual(record.rounds[1].alignments[18].hsps[0].query_end, 200)
06670         self.assertEqual(record.rounds[1].alignments[18].hsps[0].sbjct_start, 167)
06671         self.assertEqual(record.rounds[1].alignments[18].hsps[0].sbjct_end, 354)
06672         self.assertEqual(record.rounds[1].alignments[19].hsps[0].query, "TRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVF--------HADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06673         self.assertEqual(record.rounds[1].alignments[19].hsps[0].match, "+R + I R T+E+ I + ++LDGTGQ  + TG+ F DHMLT L  H+ FDL +   GD E   ++ HH IED AIALG  + + LG+K GIRR+G   IPMDE L    +D+SGRPY V         H  ++G+     Y T +    F +LA NA I LH+   YG++ HHI E  +K+ ARAL+QAV  D   V  +PS+KG L")
06674         self.assertEqual(record.rounds[1].alignments[19].hsps[0].sbjct, "SRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVE---IEAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSV--PYHTVINRHVFESLAANARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPR-VSGVPSTKGAL")
06675         self.assertEqual(record.rounds[1].alignments[19].hsps[0].query_start, 2)
06676         self.assertEqual(record.rounds[1].alignments[19].hsps[0].query_end, 200)
06677         self.assertEqual(record.rounds[1].alignments[19].hsps[0].sbjct_start, 10)
06678         self.assertEqual(record.rounds[1].alignments[19].hsps[0].sbjct_end, 210)
06679         self.assertEqual(record.rounds[1].alignments[20].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06680         self.assertEqual(record.rounds[1].alignments[20].hsps[0].match, "R S  TR T ET +++ + +DG+G++ ++TG+GFLDHML  +  H   DL++   GD E   +D HH +EDVA+ LG+ + E LG+K GIRR     +PMD+AL T  LD+SGRPY V   +   +  +G   ++    F  +LA +A + +H +   G+N HH  E +FK+ A A++ AV ++    GEIPS+KG L")
06681         self.assertEqual(record.rounds[1].alignments[20].hsps[0].sbjct, "RRSMKTRETLETHVKVDLEIDGSGKSSVNTGLGFLDHMLESVARHGLLDLEVEARGDLE---VDDHHTVEDVALTLGEALREALGDKSGIRRMAHAMVPMDDALATVALDLSGRPYTVLELEFD-DAVIGDVKSQNIGHFIESLAVSAAMNIHASV-RGRNDHHKAEALFKALALAIRDAVRVEH---GEIPSTKGKL")
06682         self.assertEqual(record.rounds[1].alignments[20].hsps[0].query_start, 3)
06683         self.assertEqual(record.rounds[1].alignments[20].hsps[0].query_end, 200)
06684         self.assertEqual(record.rounds[1].alignments[20].hsps[0].sbjct_start, 5)
06685         self.assertEqual(record.rounds[1].alignments[20].hsps[0].sbjct_end, 194)
06686         self.assertEqual(record.rounds[1].alignments[21].hsps[0].query, "RISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKG")
06687         self.assertEqual(record.rounds[1].alignments[21].hsps[0].match, "RI  + R TKET I L IN+DGTG+  I TGI F DH+L     H  FDL +   GD E   +D HH +EDV I LG  +++    K  I R+G   IPMD+A  T  +D+SGR Y V + +    + +G   TE    FF ++A    + +H     G+N HH  E +FK+   AL  A  IDE K   + S+KG")
06688         self.assertEqual(record.rounds[1].alignments[21].hsps[0].sbjct, "RIFEVMRETKETNIYLKINIDGTGKYKIDTGIPFFDHLLASFAKHGCFDLIVKARGDLE---IDDHHTVEDVGICLGLALNQI--EKRNIFRFGWAIIPMDDARATVAIDLSGRSYCVGNYE-PKREFVGDLATENINHFFESVASYGMLNIHYEVI-GKNEHHKAEALFKAFGVALDLATKIDERK--GVISTKG")
06689         self.assertEqual(record.rounds[1].alignments[21].hsps[0].query_start, 3)
06690         self.assertEqual(record.rounds[1].alignments[21].hsps[0].query_end, 198)
06691         self.assertEqual(record.rounds[1].alignments[21].hsps[0].sbjct_start, 7)
06692         self.assertEqual(record.rounds[1].alignments[21].hsps[0].sbjct_end, 193)
06693         self.assertEqual(record.rounds[1].alignments[22].hsps[0].query, "RISHITRNTKETQIELSINLDG------------------------TGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALK")
06694         self.assertEqual(record.rounds[1].alignments[22].hsps[0].match, "R + ++R+T ET I++++++DG                        +    I+TGIGFLDHML  L  H+ + + +   GD   + +D HH  ED  IA+G   ++ LG   G+ R+G    P+DEAL    +D+S RPY V    L   +KLG    EM     ++ A  A ITLH++   G N HH  E  FK+ A A++")
06695         self.assertEqual(record.rounds[1].alignments[22].hsps[0].sbjct, "RAAALSRDTNETSIQIALSIDGGELPQDADPRLLEASSAHASQTSKSQVISINTGIGFLDHMLHALAKHAGWSMALNCKGD---LHIDDHHTAEDCCIAVGTTFAKALGALTGVARFGYAYAPLDEALSRAVVDLSNRPYTVVDLGLK-REKLGELSCEMIPHCLQSFAQAARITLHVDCLRGDNDHHRAESAFKALAVAVR")
06696         self.assertEqual(record.rounds[1].alignments[22].hsps[0].query_start, 3)
06697         self.assertEqual(record.rounds[1].alignments[22].hsps[0].query_end, 180)
06698         self.assertEqual(record.rounds[1].alignments[22].hsps[0].sbjct_start, 8)
06699         self.assertEqual(record.rounds[1].alignments[22].hsps[0].sbjct_end, 205)
06700         self.assertEqual(record.rounds[1].alignments[23].hsps[0].query, "MTRISHITRNTKETQIELSINLDGTGQADISTGIGFLDHMLTLLTFHSDFDLKIIGHGDHETVGMDPHHLIEDVAIALGKCISEDLGNKLGIRRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEEFFRALAFNAGITLHLNEHYGQNTHHIIEGMFKSTARALKQAVSIDESKVGEIPSSKGVL")
06701         self.assertEqual(record.rounds[1].alignments[23].hsps[0].match, "M+R ++ITR TKET+IE+ +++D  G+  +ST I F +HML  L  + +    +      + +  D HH++EDVAI LG  I   LG+K GI+R+    IPMD+ALV   LDIS R     + +L  ++ +GG  TE    FF++ A+N+GITLH+++  G NTHHIIE  FK+   AL +A  I ++   EI S+KG++")
06702         self.assertEqual(record.rounds[1].alignments[23].hsps[0].sbjct, "MSRSANITRETKETKIEVLLDIDRKGEVKVSTPIPFFNHMLITLLTYMNSTAIVSAT---DKLPYDDHHIVEDVAITLGLAIKTALGDKRGIKRFSHQIIPMDDALVLVSLDISNRGMAFVNLNLKRSE-IGGLATENVPHFFQSFAYNSGITLHISQLSGYNTHHIIEASFKALGLALYEATRIVDN---EIRSTKGII")
06703         self.assertEqual(record.rounds[1].alignments[23].hsps[0].query_start, 1)
06704         self.assertEqual(record.rounds[1].alignments[23].hsps[0].query_end, 200)
06705         self.assertEqual(record.rounds[1].alignments[23].hsps[0].sbjct_start, 1)
06706         self.assertEqual(record.rounds[1].alignments[23].hsps[0].sbjct_end, 193)
06707         self.assertEqual(record.rounds[1].alignments[24].hsps[0].query, "LTLLTFHSDFDLKIIGHGDHETVGMDPH-HLIEDVAIAL------GKCISEDLG----NKLGI--------RRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEE")
06708         self.assertEqual(record.rounds[1].alignments[24].hsps[0].match, "L  +  +    + +       T+ M  H ++++  A+        G    E LG    +   I                PM +A  +  +D+   P L+F        + G + +++   ")
06709         self.assertEqual(record.rounds[1].alignments[24].hsps[0].sbjct, "LAEVAKNRGIAIPVDLDSQVNTLFMKSHSNMVQRAAMGWRLSARSGPRFKEALGGPAWDYRNIIEKLQDVVASLEHQFSPMMQAEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINH")
06710         self.assertEqual(record.rounds[1].alignments[24].hsps[0].query_start, 41)
06711         self.assertEqual(record.rounds[1].alignments[24].hsps[0].query_end, 141)
06712         self.assertEqual(record.rounds[1].alignments[24].hsps[0].sbjct_start, 1540)
06713         self.assertEqual(record.rounds[1].alignments[24].hsps[0].sbjct_end, 1659)
06714         self.assertEqual(record.rounds[1].alignments[25].hsps[0].query, "LTLLTFHSDFDLKIIGHGDHETVGMDPHH-LIEDVAIAL------GKCISEDLG----NKLGI--------RRYGSFTIPMDEALVTCDLDISGRPYLVFHADLSGNQKLGGYDTEMTEE")
06715         self.assertEqual(record.rounds[1].alignments[25].hsps[0].match, "L  +  +    + +       T+ M  H   ++  A+        G    E LG    +   I                PM +A  +  +D+   P L+F        + G + +++   ")
06716         self.assertEqual(record.rounds[1].alignments[25].hsps[0].sbjct, "LAEVAKNRGIAIPVDLDSQVNTLFMKNHSSTVQRAAMGWRLSARSGPRFKEALGGPAWDYRNIIEKLQDVVASLEQQFSPMMQAEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINH")
06717         self.assertEqual(record.rounds[1].alignments[25].hsps[0].query_start, 41)
06718         self.assertEqual(record.rounds[1].alignments[25].hsps[0].query_end, 141)
06719         self.assertEqual(record.rounds[1].alignments[25].hsps[0].sbjct_start, 1540)
06720         self.assertEqual(record.rounds[1].alignments[25].hsps[0].sbjct_end, 1659)

Here is the caller graph for this function:

def test_NCBITextParser.TestNCBITextParser._check_bt047_round0 (   self,
  record 
) [private]

Definition at line 5721 of file test_NCBITextParser.py.

05721 
05722     def _check_bt047_round0(self, record):
05723         self.assertEqual(record.rounds[0].new_seqs[0].title, "gi|399896|sp|Q02134|HIS7_LACLA IMIDAZOLEGLYCEROL-PHOSPHATE DEHY...")
05724         self.assertEqual(record.rounds[0].new_seqs[0].score, 409)
05725         self.assertAlmostEqual(record.rounds[0].new_seqs[0].e, 1e-114)
05726         self.assertEqual(record.rounds[0].new_seqs[1].title, "gi|462273|sp|P34047|HIS7_ARATH IMIDAZOLEGLYCEROL-PHOSPHATE DEHY...")
05727         self.assertEqual(record.rounds[0].new_seqs[1].score, 198)
05728         self.assertAlmostEqual(record.rounds[0].new_seqs[1].e, 6e-51)
05729         self.assertEqual(record.rounds[0].new_seqs[2].title, "gi|2495230|sp|Q43072|HIS7_PEA IMIDAZOLEGLYCEROL-PHOSPHATE DEHYD...")
05730         self.assertEqual(record.rounds[0].new_seqs[2].score, 196)
05731         self.assertAlmostEqual(record.rounds[0].new_seqs[2].e, 4e-50)
05732         self.assertEqual(record.rounds[0].new_seqs[3].title, "gi|123157|sp|P18787|HIS7_AZOBR IMIDAZOLEGLYCEROL-PHOSPHATE DEHY...")
05733         self.assertEqual(record.rounds[0].new_seqs[3].score, 185)
05734         self.assertAlmostEqual(record.rounds[0].new_seqs[3].e, 5e-47)
05735         self.assertEqual(record.rounds[0].new_seqs[4].title, "gi|462275|sp|P34048|HIS7_WHEAT IMIDAZOLEGLYCEROL-PHOSPHATE DEHY...")
05736         self.assertEqual(record.rounds[0].new_seqs[4].score, 181)
05737         self.assertAlmostEqual(record.rounds[0].new_seqs[4].e, 8e-46)
05738         self.assertEqual(record.rounds[0].new_seqs[5].title, "gi|123161|sp|P16247|HIS7_STRCO IMIDAZOLEGLYCEROL-PHOSPHATE DEHY...")
05739         self.assertEqual(record.rounds[0].new_seqs[5].score, 178)
05740         self.assertAlmostEqual(record.rounds[0].new_seqs[5].e, 7e-45)
05741         self.assertEqual(record.rounds[0].new_seqs[6].title, "gi|462272|sp|Q05068|HIS7_ANASP IMIDAZOLEGLYCEROL-PHOSPHATE DEHY...")
05742         self.assertEqual(record.rounds[0].new_seqs[6].score, 178)
05743         self.assertAlmostEqual(record.rounds[0].new_seqs[6].e, 7e-45)
05744         self.assertEqual(record.rounds[0].new_seqs[7].title, "gi|123158|sp|P06987|HIS7_ECOLI HISTIDINE BIOSYNTHESIS BIFUNCTIO...")
05745         self.assertEqual(record.rounds[0].new_seqs[7].score, 175)
05746         self.assertAlmostEqual(record.rounds[0].new_seqs[7].e, 8e-44)
05747         self.assertEqual(record.rounds[0].new_seqs[8].title, "gi|1346293|sp|P48054|HIS7_SYNY3 IMIDAZOLEGLYCEROL-PHOSPHATE DEH...")
05748         self.assertEqual(record.rounds[0].new_seqs[8].score, 174)
05749         self.assertAlmostEqual(record.rounds[0].new_seqs[8].e, 1e-43)
05750         self.assertEqual(record.rounds[0].new_seqs[9].title, "gi|1170286|sp|P44327|HIS7_HAEIN HISTIDINE BIOSYNTHESIS BIFUNCTI...")
05751         self.assertEqual(record.rounds[0].new_seqs[9].score, 168)
05752         self.assertAlmostEqual(record.rounds[0].new_seqs[9].e, 8e-42)
05753         self.assertEqual(record.rounds[0].new_seqs[10].title, "gi|2495224|sp|O06590|HIS7_MYCTU IMIDAZOLEGLYCEROL-PHOSPHATE DEH...")
05754         self.assertEqual(record.rounds[0].new_seqs[10].score, 167)
05755         self.assertAlmostEqual(record.rounds[0].new_seqs[10].e, 2e-41)
05756         self.assertEqual(record.rounds[0].new_seqs[11].title, "gi|123160|sp|P10368|HIS7_SALTY HISTIDINE BIOSYNTHESIS BIFUNCTIO...")
05757         self.assertEqual(record.rounds[0].new_seqs[11].score, 166)
05758         self.assertAlmostEqual(record.rounds[0].new_seqs[11].e, 2e-41)
05759         self.assertEqual(record.rounds[0].new_seqs[12].title, "gi|2495226|sp|Q50504|HIS7_METTH PROBABLE IMIDAZOLEGLYCEROL-PHOS...")
05760         self.assertEqual(record.rounds[0].new_seqs[12].score, 153)
05761         self.assertAlmostEqual(record.rounds[0].new_seqs[12].e, 3e-37)
05762         self.assertEqual(record.rounds[0].new_seqs[13].title, "gi|729718|sp|P40919|HIS7_CRYNE IMIDAZOLEGLYCEROL-PHOSPHATE DEHY...")
05763         self.assertEqual(record.rounds[0].new_seqs[13].score, 152)
05764         self.assertAlmostEqual(record.rounds[0].new_seqs[13].e, 7e-37)
05765         self.assertEqual(record.rounds[0].new_seqs[14].title, "gi|3334215|sp|O33773|HIS7_SULSO PROBABLE IMIDAZOLEGLYCEROL-PHOS...")
05766         self.assertEqual(record.rounds[0].new_seqs[14].score, 151)
05767         self.assertAlmostEqual(record.rounds[0].new_seqs[14].e, 9e-37)
05768         self.assertEqual(record.rounds[0].new_seqs[15].title, "gi|123159|sp|P28624|HIS7_PHYPR IMIDAZOLEGLYCEROL-PHOSPHATE DEHY...")
05769         self.assertEqual(record.rounds[0].new_seqs[15].score, 149)
05770         self.assertAlmostEqual(record.rounds[0].new_seqs[15].e, 3e-36)
05771         self.assertEqual(record.rounds[0].new_seqs[16].title, "gi|729719|sp|P40374|HIS7_SCHPO IMIDAZOLEGLYCEROL-PHOSPHATE DEHY...")
05772         self.assertEqual(record.rounds[0].new_seqs[16].score, 136)
05773         self.assertAlmostEqual(record.rounds[0].new_seqs[16].e, 3e-32)
05774         self.assertEqual(record.rounds[0].new_seqs[17].title, "gi|2495227|sp|P56090|HIS7_CANAL IMIDAZOLEGLYCEROL-PHOSPHATE DEH...")
05775         self.assertEqual(record.rounds[0].new_seqs[17].score, 128)
05776         self.assertAlmostEqual(record.rounds[0].new_seqs[17].e, 9e-30)
05777         self.assertEqual(record.rounds[0].new_seqs[18].title, "gi|2495225|sp|Q58109|HIS7_METJA PROBABLE IMIDAZOLEGLYCEROL-PHOS...")
05778         self.assertEqual(record.rounds[0].new_seqs[18].score, 126)
05779         self.assertAlmostEqual(record.rounds[0].new_seqs[18].e, 4e-29)
05780         self.assertEqual(record.rounds[0].new_seqs[19].title, "gi|2495229|sp|Q92447|HIS7_PICPA IMIDAZOLEGLYCEROL-PHOSPHATE DEH...")
05781         self.assertEqual(record.rounds[0].new_seqs[19].score, 125)
05782         self.assertAlmostEqual(record.rounds[0].new_seqs[19].e, 6e-29)
05783         self.assertEqual(record.rounds[0].new_seqs[20].title, "gi|399897|sp|Q02986|HIS7_SACKL IMIDAZOLEGLYCEROL-PHOSPHATE DEHY...")
05784         self.assertEqual(record.rounds[0].new_seqs[20].score, 125)
05785         self.assertAlmostEqual(record.rounds[0].new_seqs[20].e, 6e-29)
05786         self.assertEqual(record.rounds[0].new_seqs[21].title, "gi|2495228|sp|Q12578|HIS7_CANGA IMIDAZOLEGLYCEROL-PHOSPHATE DEH...")
05787         self.assertEqual(record.rounds[0].new_seqs[21].score, 123)
05788         self.assertAlmostEqual(record.rounds[0].new_seqs[21].e, 2e-28)
05789         self.assertEqual(record.rounds[0].new_seqs[22].title, "gi|2506514|sp|P06633|HIS7_YEAST IMIDAZOLEGLYCEROL-PHOSPHATE DEH...")
05790         self.assertEqual(record.rounds[0].new_seqs[22].score, 122)
05791         self.assertAlmostEqual(record.rounds[0].new_seqs[22].e, 4e-28)
05792         self.assertEqual(record.rounds[0].new_seqs[23].title, "gi|462274|sp|P34041|HIS7_TRIHA IMIDAZOLEGLYCEROL-PHOSPHATE DEHY...")
05793         self.assertEqual(record.rounds[0].new_seqs[23].score, 106)
05794         self.assertAlmostEqual(record.rounds[0].new_seqs[23].e, 3e-23)
05795         self.assertEqual(record.rounds[0].new_seqs[24].title, "gi|1345641|sp|P49264|C7B1_THLAR CYTOCHROME P450 71B1 (CYPLXXIB1)")
05796         self.assertEqual(record.rounds[0].new_seqs[24].score, 35)
05797         self.assertAlmostEqual(record.rounds[0].new_seqs[24].e, 0.13)
05798         self.assertEqual(record.rounds[0].new_seqs[25].title, "gi|1731346|sp|Q10698|YY29_MYCTU PROBABLE DIPEPTIDASE CY49.29C")
05799         self.assertEqual(record.rounds[0].new_seqs[25].score, 32)
05800         self.assertAlmostEqual(record.rounds[0].new_seqs[25].e, 1.1)
05801         self.assertEqual(record.rounds[0].new_seqs[26].title, "gi|3287839|sp|Q01812|GLK4_RAT GLUTAMATE RECEPTOR, IONOTROPIC KA...")
05802         self.assertEqual(record.rounds[0].new_seqs[26].score, 30)
05803         self.assertAlmostEqual(record.rounds[0].new_seqs[26].e, 3.3)
05804         self.assertEqual(record.rounds[0].new_seqs[27].title, "gi|3123025|sp|Q94637|VIT6_OSCBR VITELLOGENIN 6 PRECURSOR")
05805         self.assertEqual(record.rounds[0].new_seqs[27].score, 29)
05806         self.assertAlmostEqual(record.rounds[0].new_seqs[27].e, 5.6)
05807         self.assertEqual(record.rounds[0].new_seqs[28].title, "gi|1174406|sp|P36126|SP14_YEAST PHOSPHOLIPASE D1 (PLD 1) (CHOLI...")
05808         self.assertEqual(record.rounds[0].new_seqs[28].score, 29)
05809         self.assertAlmostEqual(record.rounds[0].new_seqs[28].e, 9.7)
05810         self.assertEqual(record.rounds[0].new_seqs[29].title, "gi|3287848|sp|Q16099|GLK4_HUMAN GLUTAMATE RECEPTOR, IONOTROPIC ...")
05811         self.assertEqual(record.rounds[0].new_seqs[29].score, 29)
05812         self.assertAlmostEqual(record.rounds[0].new_seqs[29].e, 9.7)
05813         self.assertEqual(len(record.rounds[0].alignments), 30)
05814         self.assertEqual(record.rounds[0].alignments[0].title, ">gi|399896|sp|Q02134|HIS7_LACLA IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05815         self.assertEqual(record.rounds[0].alignments[0].length, 200)
05816         self.assertEqual(record.rounds[0].alignments[1].title, ">gi|462273|sp|P34047|HIS7_ARATH IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05817         self.assertEqual(record.rounds[0].alignments[1].length, 270)
05818         self.assertEqual(record.rounds[0].alignments[2].title, ">gi|2495230|sp|Q43072|HIS7_PEA IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05819         self.assertEqual(record.rounds[0].alignments[2].length, 281)
05820         self.assertEqual(record.rounds[0].alignments[3].title, ">gi|123157|sp|P18787|HIS7_AZOBR IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05821         self.assertEqual(record.rounds[0].alignments[3].length, 207)
05822         self.assertEqual(record.rounds[0].alignments[4].title, ">gi|462275|sp|P34048|HIS7_WHEAT IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05823         self.assertEqual(record.rounds[0].alignments[4].length, 195)
05824         self.assertEqual(record.rounds[0].alignments[5].title, ">gi|123161|sp|P16247|HIS7_STRCO IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05825         self.assertEqual(record.rounds[0].alignments[5].length, 197)
05826         self.assertEqual(record.rounds[0].alignments[6].title, ">gi|462272|sp|Q05068|HIS7_ANASP IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05827         self.assertEqual(record.rounds[0].alignments[6].length, 209)
05828         self.assertEqual(record.rounds[0].alignments[7].title, ">gi|123158|sp|P06987|HIS7_ECOLI HISTIDINE BIOSYNTHESIS BIFUNCTIONAL PROTEIN HISB [INCLUDES: IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD); HISTIDINOL-PHOSPHATASE ]")
05829         self.assertEqual(record.rounds[0].alignments[7].length, 355)
05830         self.assertEqual(record.rounds[0].alignments[8].title, ">gi|1346293|sp|P48054|HIS7_SYNY3 IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05831         self.assertEqual(record.rounds[0].alignments[8].length, 210)
05832         self.assertEqual(record.rounds[0].alignments[9].title, ">gi|1170286|sp|P44327|HIS7_HAEIN HISTIDINE BIOSYNTHESIS BIFUNCTIONAL PROTEIN HISB [INCLUDES: IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD); HISTIDINOL-PHOSPHATASE ]")
05833         self.assertEqual(record.rounds[0].alignments[9].length, 362)
05834         self.assertEqual(record.rounds[0].alignments[10].title, ">gi|2495224|sp|O06590|HIS7_MYCTU IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05835         self.assertEqual(record.rounds[0].alignments[10].length, 210)
05836         self.assertEqual(record.rounds[0].alignments[11].title, ">gi|123160|sp|P10368|HIS7_SALTY HISTIDINE BIOSYNTHESIS BIFUNCTIONAL PROTEIN HISB [INCLUDES: IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD); HISTIDINOL-PHOSPHATASE ]")
05837         self.assertEqual(record.rounds[0].alignments[11].length, 354)
05838         self.assertEqual(record.rounds[0].alignments[12].title, ">gi|2495226|sp|Q50504|HIS7_METTH PROBABLE IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05839         self.assertEqual(record.rounds[0].alignments[12].length, 194)
05840         self.assertEqual(record.rounds[0].alignments[13].title, ">gi|729718|sp|P40919|HIS7_CRYNE IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05841         self.assertEqual(record.rounds[0].alignments[13].length, 202)
05842         self.assertEqual(record.rounds[0].alignments[14].title, ">gi|3334215|sp|O33773|HIS7_SULSO PROBABLE IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05843         self.assertEqual(record.rounds[0].alignments[14].length, 193)
05844         self.assertEqual(record.rounds[0].alignments[15].title, ">gi|123159|sp|P28624|HIS7_PHYPR IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05845         self.assertEqual(record.rounds[0].alignments[15].length, 452)
05846         self.assertEqual(record.rounds[0].alignments[16].title, ">gi|729719|sp|P40374|HIS7_SCHPO IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05847         self.assertEqual(record.rounds[0].alignments[16].length, 216)
05848         self.assertEqual(record.rounds[0].alignments[17].title, ">gi|2495227|sp|P56090|HIS7_CANAL IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05849         self.assertEqual(record.rounds[0].alignments[17].length, 223)
05850         self.assertEqual(record.rounds[0].alignments[18].title, ">gi|2495225|sp|Q58109|HIS7_METJA PROBABLE IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05851         self.assertEqual(record.rounds[0].alignments[18].length, 197)
05852         self.assertEqual(record.rounds[0].alignments[19].title, ">gi|2495229|sp|Q92447|HIS7_PICPA IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05853         self.assertEqual(record.rounds[0].alignments[19].length, 224)
05854         self.assertEqual(record.rounds[0].alignments[20].title, ">gi|399897|sp|Q02986|HIS7_SACKL IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05855         self.assertEqual(record.rounds[0].alignments[20].length, 232)
05856         self.assertEqual(record.rounds[0].alignments[21].title, ">gi|2495228|sp|Q12578|HIS7_CANGA IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05857         self.assertEqual(record.rounds[0].alignments[21].length, 210)
05858         self.assertEqual(record.rounds[0].alignments[22].title, ">gi|2506514|sp|P06633|HIS7_YEAST IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05859         self.assertEqual(record.rounds[0].alignments[22].length, 220)
05860         self.assertEqual(record.rounds[0].alignments[23].title, ">gi|462274|sp|P34041|HIS7_TRIHA IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05861         self.assertEqual(record.rounds[0].alignments[23].length, 208)
05862         self.assertEqual(record.rounds[0].alignments[24].title, ">gi|1345641|sp|P49264|C7B1_THLAR CYTOCHROME P450 71B1 (CYPLXXIB1)")
05863         self.assertEqual(record.rounds[0].alignments[24].length, 496)
05864         self.assertEqual(record.rounds[0].alignments[25].title, ">gi|1731346|sp|Q10698|YY29_MYCTU PROBABLE DIPEPTIDASE CY49.29C")
05865         self.assertEqual(record.rounds[0].alignments[25].length, 375)
05866         self.assertEqual(record.rounds[0].alignments[26].title, ">gi|3287839|sp|Q01812|GLK4_RAT GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 4 PRECURSOR (GLUTAMATE RECEPTOR KA-1) (KA1)")
05867         self.assertEqual(record.rounds[0].alignments[26].length, 956)
05868         self.assertEqual(record.rounds[0].alignments[27].title, ">gi|3123025|sp|Q94637|VIT6_OSCBR VITELLOGENIN 6 PRECURSOR")
05869         self.assertEqual(record.rounds[0].alignments[27].length, 1660)
05870         self.assertEqual(record.rounds[0].alignments[28].title, ">gi|1174406|sp|P36126|SP14_YEAST PHOSPHOLIPASE D1 (PLD 1) (CHOLINE PHOSPHATASE 1) (PHOSPHATIDYLCHOLINE-HYDROLYZING PHOSPHOLIPASE D1) (MEIOSIS-SPECIFIC SPORULATION PROTEIN SPO14)")
05871         self.assertEqual(record.rounds[0].alignments[28].length, 1380)
05872         self.assertEqual(record.rounds[0].alignments[29].title, ">gi|3287848|sp|Q16099|GLK4_HUMAN GLUTAMATE RECEPTOR, IONOTROPIC KAINATE 4 PRECURSOR (GLUTAMATE RECEPTOR KA-1) (KA1) (EXCITATORY AMINO ACID RECEPTOR 1) (EAA1)")
05873         self.assertEqual(record.rounds[0].alignments[29].length, 956)

Here is the caller graph for this function:

def test_NCBITextParser.TestNCBITextParser._check_bt047_round1 (   self,
  record 
) [private]

Definition at line 5874 of file test_NCBITextParser.py.

05874 
05875     def _check_bt047_round1(self, record):
05876         self.assertEqual(len(record.rounds[1].new_seqs), 2)
05877         self.assertEqual(record.rounds[1].new_seqs[0].title, "gi|2833252|sp|Q14571|IP3S_HUMAN INOSITOL 1,4,5-TRISPHOSPHATE-BI...")
05878         self.assertEqual(record.rounds[1].new_seqs[0].score, 30)
05879         self.assertAlmostEqual(record.rounds[1].new_seqs[0].e, 3.7)
05880         self.assertEqual(record.rounds[1].new_seqs[1].title, "gi|266389|sp|P29995|IP3S_RAT INOSITOL 1,4,5-TRISPHOSPHATE-BINDI...")
05881         self.assertEqual(record.rounds[1].new_seqs[1].score, 29)
05882         self.assertAlmostEqual(record.rounds[1].new_seqs[1].e, 8.2)
05883         self.assertEqual(len(record.rounds[1].alignments), 26)
05884         self.assertEqual(record.rounds[1].alignments[0].title, ">gi|2495230|sp|Q43072|HIS7_PEA IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05885         self.assertEqual(record.rounds[1].alignments[0].length, 281)
05886         self.assertEqual(record.rounds[1].alignments[1].title, ">gi|462273|sp|P34047|HIS7_ARATH IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05887         self.assertEqual(record.rounds[1].alignments[1].length, 270)
05888         self.assertEqual(record.rounds[1].alignments[2].title, ">gi|399896|sp|Q02134|HIS7_LACLA IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05889         self.assertEqual(record.rounds[1].alignments[2].length, 200)
05890         self.assertEqual(record.rounds[1].alignments[3].title, ">gi|1346293|sp|P48054|HIS7_SYNY3 IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05891         self.assertEqual(record.rounds[1].alignments[3].length, 210)
05892         self.assertEqual(record.rounds[1].alignments[4].title, ">gi|462272|sp|Q05068|HIS7_ANASP IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05893         self.assertEqual(record.rounds[1].alignments[4].length, 209)
05894         self.assertEqual(record.rounds[1].alignments[5].title, ">gi|462275|sp|P34048|HIS7_WHEAT IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05895         self.assertEqual(record.rounds[1].alignments[5].length, 195)
05896         self.assertEqual(record.rounds[1].alignments[6].title, ">gi|123161|sp|P16247|HIS7_STRCO IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05897         self.assertEqual(record.rounds[1].alignments[6].length, 197)
05898         self.assertEqual(record.rounds[1].alignments[7].title, ">gi|2506514|sp|P06633|HIS7_YEAST IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05899         self.assertEqual(record.rounds[1].alignments[7].length, 220)
05900         self.assertEqual(record.rounds[1].alignments[8].title, ">gi|2495227|sp|P56090|HIS7_CANAL IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05901         self.assertEqual(record.rounds[1].alignments[8].length, 223)
05902         self.assertEqual(record.rounds[1].alignments[9].title, ">gi|399897|sp|Q02986|HIS7_SACKL IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05903         self.assertEqual(record.rounds[1].alignments[9].length, 232)
05904         self.assertEqual(record.rounds[1].alignments[10].title, ">gi|2495228|sp|Q12578|HIS7_CANGA IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05905         self.assertEqual(record.rounds[1].alignments[10].length, 210)
05906         self.assertEqual(record.rounds[1].alignments[11].title, ">gi|123158|sp|P06987|HIS7_ECOLI HISTIDINE BIOSYNTHESIS BIFUNCTIONAL PROTEIN HISB [INCLUDES: IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD); HISTIDINOL-PHOSPHATASE ]")
05907         self.assertEqual(record.rounds[1].alignments[11].length, 355)
05908         self.assertEqual(record.rounds[1].alignments[12].title, ">gi|123157|sp|P18787|HIS7_AZOBR IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05909         self.assertEqual(record.rounds[1].alignments[12].length, 207)
05910         self.assertEqual(record.rounds[1].alignments[13].title, ">gi|729718|sp|P40919|HIS7_CRYNE IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05911         self.assertEqual(record.rounds[1].alignments[13].length, 202)
05912         self.assertEqual(record.rounds[1].alignments[14].title, ">gi|2495229|sp|Q92447|HIS7_PICPA IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05913         self.assertEqual(record.rounds[1].alignments[14].length, 224)
05914         self.assertEqual(record.rounds[1].alignments[15].title, ">gi|1170286|sp|P44327|HIS7_HAEIN HISTIDINE BIOSYNTHESIS BIFUNCTIONAL PROTEIN HISB [INCLUDES: IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD); HISTIDINOL-PHOSPHATASE ]")
05915         self.assertEqual(record.rounds[1].alignments[15].length, 362)
05916         self.assertEqual(record.rounds[1].alignments[16].title, ">gi|123159|sp|P28624|HIS7_PHYPR IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05917         self.assertEqual(record.rounds[1].alignments[16].length, 452)
05918         self.assertEqual(record.rounds[1].alignments[17].title, ">gi|729719|sp|P40374|HIS7_SCHPO IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05919         self.assertEqual(record.rounds[1].alignments[17].length, 216)
05920         self.assertEqual(record.rounds[1].alignments[18].title, ">gi|123160|sp|P10368|HIS7_SALTY HISTIDINE BIOSYNTHESIS BIFUNCTIONAL PROTEIN HISB [INCLUDES: IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD); HISTIDINOL-PHOSPHATASE ]")
05921         self.assertEqual(record.rounds[1].alignments[18].length, 354)
05922         self.assertEqual(record.rounds[1].alignments[19].title, ">gi|2495224|sp|O06590|HIS7_MYCTU IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05923         self.assertEqual(record.rounds[1].alignments[19].length, 210)
05924         self.assertEqual(record.rounds[1].alignments[20].title, ">gi|2495226|sp|Q50504|HIS7_METTH PROBABLE IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05925         self.assertEqual(record.rounds[1].alignments[20].length, 194)
05926         self.assertEqual(record.rounds[1].alignments[21].title, ">gi|2495225|sp|Q58109|HIS7_METJA PROBABLE IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05927         self.assertEqual(record.rounds[1].alignments[21].length, 197)
05928         self.assertEqual(record.rounds[1].alignments[22].title, ">gi|462274|sp|P34041|HIS7_TRIHA IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05929         self.assertEqual(record.rounds[1].alignments[22].length, 208)
05930         self.assertEqual(record.rounds[1].alignments[23].title, ">gi|3334215|sp|O33773|HIS7_SULSO PROBABLE IMIDAZOLEGLYCEROL-PHOSPHATE DEHYDRATASE (IGPD)")
05931         self.assertEqual(record.rounds[1].alignments[23].length, 193)
05932         self.assertEqual(record.rounds[1].alignments[24].title, ">gi|2833252|sp|Q14571|IP3S_HUMAN INOSITOL 1,4,5-TRISPHOSPHATE-BINDING PROTEIN TYPE 2 RECEPTOR (TYPE 2 INSP3 RECEPTOR) (TYPE 2 INOSITOL 1,4,5-TRISPHOSPHATE RECEPTOR)")
05933         self.assertEqual(record.rounds[1].alignments[24].length, 2701)
05934         self.assertEqual(record.rounds[1].alignments[25].title, ">gi|266389|sp|P29995|IP3S_RAT INOSITOL 1,4,5-TRISPHOSPHATE-BINDING PROTEIN TYPE 2 RECEPTOR (TYPE 2 INSP3 RECEPTOR) (TYPE 2 INOSITOL 1,4,5-TRISPHOSPHATE RECEPTOR)")
05935         self.assertEqual(record.rounds[1].alignments[25].length, 2701)

Here is the caller graph for this function:

def test_NCBITextParser.TestNCBITextParser._check_bt060_footer (   self,
  record 
) [private]

Definition at line 12267 of file test_NCBITextParser.py.

12267 
12268     def _check_bt060_footer(self, record):
12269         self.assertEqual(record.database_name, ['/dbase/swissprot/main/release/sp', '/dbase/swissprot/main/update/spu'])
12270         self.assertEqual(record.posted_date, [('Jun 21, 2000 12:39 PM',), ('Nov 3, 1999  8:09 PM',)])
12271         self.assertEqual(record.num_letters_in_database, [31411157, 546183])
12272         self.assertEqual(record.num_sequences_in_database, [86593, 1608])
12273         self.assertEqual(len(record.ka_params), 3)
12274         self.assertAlmostEqual(record.ka_params[0], 0.318)
12275         self.assertAlmostEqual(record.ka_params[1], 0.131)
12276         self.assertAlmostEqual(record.ka_params[2], 0.369)
12277         self.assertEqual(len(record.ka_params_gap), 3)
12278         self.assertAlmostEqual(record.ka_params_gap[0], 0.270)
12279         self.assertAlmostEqual(record.ka_params_gap[1], 0.0458)
12280         self.assertAlmostEqual(record.ka_params_gap[2], 0.230)
12281         self.assertEqual(record.matrix, 'BLOSUM62')
12282         self.assertEqual(record.gap_penalties, [11,1])
12283         self.assertEqual(record.num_hits, 221707272)
12284         self.assertEqual(record.num_sequences, 88201)
12285         self.assertEqual(record.num_extends, 8189338)
12286         self.assertEqual(record.num_good_extends, 22743)
12287         self.assertEqual(record.num_seqs_better_e, 125)
12288         self.assertEqual(record.hsps_no_gap, 105)
12289         self.assertEqual(record.hsps_prelim_gapped, 20)
12290         self.assertEqual(record.hsps_gapped, 150)
12291         self.assertEqual(record.query_length, 889)
12292         self.assertEqual(record.database_length, 31957340)
12293         self.assertEqual(record.effective_hsp_length, 55)
12294         self.assertEqual(record.effective_query_length, 834)
12295         self.assertEqual(record.effective_database_length, 27106285)
12296         self.assertEqual(record.effective_search_space, 22606641690)
12297         self.assertEqual(record.effective_search_space_used, 22606641690)
12298         self.assertEqual(record.threshold, 11)
12299         self.assertEqual(record.window_size, 40)
12300         self.assertEqual(len(record.dropoff_1st_pass), 2)
12301         self.assertEqual(record.dropoff_1st_pass[0], 16)
12302         self.assertAlmostEqual(record.dropoff_1st_pass[1], 7.3)
12303         self.assertEqual(len(record.gap_x_dropoff), 2)
12304         self.assertEqual(record.gap_x_dropoff[0], 38)
12305         self.assertAlmostEqual(record.gap_x_dropoff[1], 14.8)
12306         self.assertEqual(len(record.gap_x_dropoff_final), 2)
12307         self.assertEqual(record.gap_x_dropoff_final[0], 64)
12308         self.assertAlmostEqual(record.gap_x_dropoff_final[1], 24.9)
12309         self.assertEqual(len(record.gap_trigger), 2)
12310         self.assertEqual(record.gap_trigger[0], 41)
12311         self.assertAlmostEqual(record.gap_trigger[1], 21.7)
12312         self.assertEqual(len(record.blast_cutoff), 2)
12313         self.assertEqual(record.blast_cutoff[0], 69)
12314         self.assertAlmostEqual(record.blast_cutoff[1], 31.3)

Here is the caller graph for this function:

def test_NCBITextParser.TestNCBITextParser._check_bt060_hsps (   self,
  record 
) [private]

Definition at line 10491 of file test_NCBITextParser.py.

10491 
10492     def _check_bt060_hsps(self, record):
10493         self.assertEqual(record.rounds[0].alignments[0].hsps[0].score, 3882)
10494         self.assertAlmostEqual(record.rounds[0].alignments[0].hsps[0].bits, 1516)
10495         self.assertAlmostEqual(record.rounds[0].alignments[0].hsps[0].expect, 0.0)
10496         self.assertEqual(len(record.rounds[0].alignments[0].hsps), 1)
10497         self.assertEqual(record.rounds[0].alignments[1].hsps[0].score, 1308)
10498         self.assertAlmostEqual(record.rounds[0].alignments[1].hsps[0].bits, 513)
10499         self.assertAlmostEqual(record.rounds[0].alignments[1].hsps[0].expect, 1e-145)
10500         self.assertEqual(record.rounds[0].alignments[1].hsps[1].score, 272)
10501         self.assertAlmostEqual(record.rounds[0].alignments[1].hsps[1].bits, 110)
10502         self.assertAlmostEqual(record.rounds[0].alignments[1].hsps[1].expect, 1e-23)
10503         self.assertEqual(len(record.rounds[0].alignments[1].hsps), 2)
10504         self.assertEqual(record.rounds[0].alignments[2].hsps[0].score, 232)
10505         self.assertAlmostEqual(record.rounds[0].alignments[2].hsps[0].bits, 94.8)
10506         self.assertAlmostEqual(record.rounds[0].alignments[2].hsps[0].expect, 7e-19)
10507         self.assertEqual(len(record.rounds[0].alignments[2].hsps), 1)
10508         self.assertEqual(record.rounds[0].alignments[3].hsps[0].score, 227)
10509         self.assertAlmostEqual(record.rounds[0].alignments[3].hsps[0].bits, 92.8)
10510         self.assertAlmostEqual(record.rounds[0].alignments[3].hsps[0].expect, 3e-18)
10511         self.assertEqual(len(record.rounds[0].alignments[3].hsps), 1)
10512         self.assertEqual(record.rounds[0].alignments[4].hsps[0].score, 214)
10513         self.assertAlmostEqual(record.rounds[0].alignments[4].hsps[0].bits, 87.8)
10514         self.assertAlmostEqual(record.rounds[0].alignments[4].hsps[0].expect, 9e-17)
10515         self.assertEqual(len(record.rounds[0].alignments[4].hsps), 1)
10516         self.assertEqual(record.rounds[0].alignments[5].hsps[0].score, 212)
10517         self.assertAlmostEqual(record.rounds[0].alignments[5].hsps[0].bits, 87.0)
10518         self.assertAlmostEqual(record.rounds[0].alignments[5].hsps[0].expect, 1e-16)
10519         self.assertEqual(len(record.rounds[0].alignments[5].hsps), 1)
10520         self.assertEqual(record.rounds[0].alignments[6].hsps[0].score, 208)
10521         self.assertAlmostEqual(record.rounds[0].alignments[6].hsps[0].bits, 85.4)
10522         self.assertAlmostEqual(record.rounds[0].alignments[6].hsps[0].expect, 4e-16)
10523         self.assertEqual(len(record.rounds[0].alignments[6].hsps), 1)
10524         self.assertEqual(record.rounds[0].alignments[7].hsps[0].score, 204)
10525         self.assertAlmostEqual(record.rounds[0].alignments[7].hsps[0].bits, 83.9)
10526         self.assertAlmostEqual(record.rounds[0].alignments[7].hsps[0].expect, 1e-15)
10527         self.assertEqual(len(record.rounds[0].alignments[7].hsps), 1)
10528         self.assertEqual(record.rounds[0].alignments[8].hsps[0].score, 202)
10529         self.assertAlmostEqual(record.rounds[0].alignments[8].hsps[0].bits, 83.1)
10530         self.assertAlmostEqual(record.rounds[0].alignments[8].hsps[0].expect, 2e-15)
10531         self.assertEqual(len(record.rounds[0].alignments[8].hsps), 1)
10532         self.assertEqual(record.rounds[0].alignments[9].hsps[0].score, 198)
10533         self.assertAlmostEqual(record.rounds[0].alignments[9].hsps[0].bits, 81.5)
10534         self.assertAlmostEqual(record.rounds[0].alignments[9].hsps[0].expect, 6e-15)
10535         self.assertEqual(len(record.rounds[0].alignments[9].hsps), 1)
10536         self.assertEqual(record.rounds[0].alignments[10].hsps[0].score, 167)
10537         self.assertAlmostEqual(record.rounds[0].alignments[10].hsps[0].bits, 69.5)
10538         self.assertAlmostEqual(record.rounds[0].alignments[10].hsps[0].expect, 3e-11)
10539         self.assertEqual(len(record.rounds[0].alignments[10].hsps), 1)
10540         self.assertEqual(record.rounds[0].alignments[11].hsps[0].score, 138)
10541         self.assertAlmostEqual(record.rounds[0].alignments[11].hsps[0].bits, 58.2)
10542         self.assertAlmostEqual(record.rounds[0].alignments[11].hsps[0].expect, 7e-8)
10543         self.assertEqual(len(record.rounds[0].alignments[11].hsps), 1)
10544         self.assertEqual(record.rounds[0].alignments[12].hsps[0].score, 133)
10545         self.assertAlmostEqual(record.rounds[0].alignments[12].hsps[0].bits, 56.2)
10546         self.assertAlmostEqual(record.rounds[0].alignments[12].hsps[0].expect, 3e-7)
10547         self.assertEqual(len(record.rounds[0].alignments[12].hsps), 1)
10548         self.assertEqual(record.rounds[0].alignments[13].hsps[0].score, 118)
10549         self.assertAlmostEqual(record.rounds[0].alignments[13].hsps[0].bits, 50.4)
10550         self.assertAlmostEqual(record.rounds[0].alignments[13].hsps[0].expect, 2e-5)
10551         self.assertEqual(len(record.rounds[0].alignments[13].hsps), 1)
10552         self.assertEqual(record.rounds[0].alignments[14].hsps[0].score, 115)
10553         self.assertAlmostEqual(record.rounds[0].alignments[14].hsps[0].bits, 49.2)
10554         self.assertAlmostEqual(record.rounds[0].alignments[14].hsps[0].expect, 3e-5)
10555         self.assertEqual(len(record.rounds[0].alignments[14].hsps), 1)
10556         self.assertEqual(record.rounds[0].alignments[15].hsps[0].score, 114)
10557         self.assertAlmostEqual(record.rounds[0].alignments[15].hsps[0].bits, 48.8)
10558         self.assertAlmostEqual(record.rounds[0].alignments[15].hsps[0].expect, 5e-5)
10559         self.assertEqual(len(record.rounds[0].alignments[15].hsps), 1)
10560         self.assertEqual(record.rounds[0].alignments[16].hsps[0].score, 112)
10561         self.assertAlmostEqual(record.rounds[0].alignments[16].hsps[0].bits, 48.0)
10562         self.assertAlmostEqual(record.rounds[0].alignments[16].hsps[0].expect, 8e-5)
10563         self.assertEqual(len(record.rounds[0].alignments[16].hsps), 1)
10564         self.assertEqual(record.rounds[0].alignments[17].hsps[0].score, 95)
10565         self.assertAlmostEqual(record.rounds[0].alignments[17].hsps[0].bits, 41.4)
10566         self.assertAlmostEqual(record.rounds[0].alignments[17].hsps[0].expect, 0.008)
10567         self.assertEqual(len(record.rounds[0].alignments[17].hsps), 1)
10568         self.assertEqual(record.rounds[0].alignments[18].hsps[0].score, 84)
10569         self.assertAlmostEqual(record.rounds[0].alignments[18].hsps[0].bits, 37.1)
10570         self.assertAlmostEqual(record.rounds[0].alignments[18].hsps[0].expect, 0.15)
10571         self.assertEqual(len(record.rounds[0].alignments[18].hsps), 1)
10572         self.assertEqual(record.rounds[0].alignments[19].hsps[0].score, 77)
10573         self.assertAlmostEqual(record.rounds[0].alignments[19].hsps[0].bits, 34.4)
10574         self.assertAlmostEqual(record.rounds[0].alignments[19].hsps[0].expect, 0.99)
10575         self.assertEqual(len(record.rounds[0].alignments[19].hsps), 1)
10576         self.assertEqual(record.rounds[0].alignments[20].hsps[0].score, 75)
10577         self.assertAlmostEqual(record.rounds[0].alignments[20].hsps[0].bits, 33.6)
10578         self.assertAlmostEqual(record.rounds[0].alignments[20].hsps[0].expect, 1.7)
10579         self.assertEqual(len(record.rounds[0].alignments[20].hsps), 1)
10580         self.assertEqual(record.rounds[0].alignments[21].hsps[0].score, 72)
10581         self.assertAlmostEqual(record.rounds[0].alignments[21].hsps[0].bits, 32.5)
10582         self.assertAlmostEqual(record.rounds[0].alignments[21].hsps[0].expect, 3.8)
10583         self.assertEqual(len(record.rounds[0].alignments[21].hsps), 1)
10584         self.assertEqual(record.rounds[0].alignments[22].hsps[0].score, 70)
10585         self.assertAlmostEqual(record.rounds[0].alignments[22].hsps[0].bits, 31.7)
10586         self.assertAlmostEqual(record.rounds[0].alignments[22].hsps[0].expect, 6.6)
10587         self.assertEqual(len(record.rounds[0].alignments[22].hsps), 1)
10588         self.assertEqual(record.rounds[0].alignments[23].hsps[0].score, 69)
10589         self.assertAlmostEqual(record.rounds[0].alignments[23].hsps[0].bits, 31.3)
10590         self.assertAlmostEqual(record.rounds[0].alignments[23].hsps[0].expect, 8.6)
10591         self.assertEqual(len(record.rounds[0].alignments[23].hsps), 1)
10592         self.assertEqual(record.rounds[0].alignments[24].hsps[0].score, 69)
10593         self.assertAlmostEqual(record.rounds[0].alignments[24].hsps[0].bits, 31.3)
10594         self.assertAlmostEqual(record.rounds[0].alignments[24].hsps[0].expect, 8.6)
10595         self.assertEqual(len(record.rounds[0].alignments[24].hsps), 1)
10596         self.assertEqual(record.rounds[0].alignments[25].hsps[0].score, 69)
10597         self.assertAlmostEqual(record.rounds[0].alignments[25].hsps[0].bits, 31.3)
10598         self.assertAlmostEqual(record.rounds[0].alignments[25].hsps[0].expect, 8.6)
10599         self.assertEqual(len(record.rounds[0].alignments[25].hsps), 1)
10600         self.assertEqual(record.rounds[0].alignments[26].hsps[0].score, 69)
10601         self.assertAlmostEqual(record.rounds[0].alignments[26].hsps[0].bits, 31.3)
10602         self.assertAlmostEqual(record.rounds[0].alignments[26].hsps[0].expect, 8.6)
10603         self.assertEqual(record.rounds[1].alignments[0].hsps[0].score, 3163)
10604         self.assertAlmostEqual(record.rounds[1].alignments[0].hsps[0].bits, 1236)
10605         self.assertAlmostEqual(record.rounds[1].alignments[0].hsps[0].expect, 0.0)
10606         self.assertEqual(len(record.rounds[1].alignments[0].hsps), 1)
10607         self.assertEqual(record.rounds[1].alignments[1].hsps[0].score, 1810)
10608         self.assertAlmostEqual(record.rounds[1].alignments[1].hsps[0].bits, 709)
10609         self.assertAlmostEqual(record.rounds[1].alignments[1].hsps[0].expect, 0.0)
10610         self.assertEqual(record.rounds[1].alignments[1].hsps[1].score, 649)
10611         self.assertAlmostEqual(record.rounds[1].alignments[1].hsps[1].bits, 257)
10612         self.assertAlmostEqual(record.rounds[1].alignments[1].hsps[1].expect, 8e-68)
10613         self.assertEqual(len(record.rounds[1].alignments[1].hsps), 2)
10614         self.assertEqual(record.rounds[1].alignments[2].hsps[0].score, 873)
10615         self.assertAlmostEqual(record.rounds[1].alignments[2].hsps[0].bits, 344)
10616         self.assertAlmostEqual(record.rounds[1].alignments[2].hsps[0].expect, 4e-94)
10617         self.assertEqual(len(record.rounds[1].alignments[2].hsps), 1)
10618         self.assertEqual(record.rounds[1].alignments[3].hsps[0].score, 870)
10619         self.assertAlmostEqual(record.rounds[1].alignments[3].hsps[0].bits, 343)
10620         self.assertAlmostEqual(record.rounds[1].alignments[3].hsps[0].expect, 1e-93)
10621         self.assertEqual(len(record.rounds[1].alignments[3].hsps), 1)
10622         self.assertEqual(record.rounds[1].alignments[4].hsps[0].score, 870)
10623         self.assertAlmostEqual(record.rounds[1].alignments[4].hsps[0].bits, 343)
10624         self.assertAlmostEqual(record.rounds[1].alignments[4].hsps[0].expect, 1e-93)
10625         self.assertEqual(len(record.rounds[1].alignments[4].hsps), 1)
10626         self.assertEqual(record.rounds[1].alignments[5].hsps[0].score, 825)
10627         self.assertAlmostEqual(record.rounds[1].alignments[5].hsps[0].bits, 325)
10628         self.assertAlmostEqual(record.rounds[1].alignments[5].hsps[0].expect, 2e-88)
10629         self.assertEqual(len(record.rounds[1].alignments[5].hsps), 1)
10630         self.assertEqual(record.rounds[1].alignments[6].hsps[0].score, 795)
10631         self.assertAlmostEqual(record.rounds[1].alignments[6].hsps[0].bits, 314)
10632         self.assertAlmostEqual(record.rounds[1].alignments[6].hsps[0].expect, 6e-85)
10633         self.assertEqual(len(record.rounds[1].alignments[6].hsps), 1)
10634         self.assertEqual(record.rounds[1].alignments[7].hsps[0].score, 765)
10635         self.assertAlmostEqual(record.rounds[1].alignments[7].hsps[0].bits, 302)
10636         self.assertAlmostEqual(record.rounds[1].alignments[7].hsps[0].expect, 2e-81)
10637         self.assertEqual(len(record.rounds[1].alignments[7].hsps), 1)
10638         self.assertEqual(record.rounds[1].alignments[8].hsps[0].score, 711)
10639         self.assertAlmostEqual(record.rounds[1].alignments[8].hsps[0].bits, 281)
10640         self.assertAlmostEqual(record.rounds[1].alignments[8].hsps[0].expect, 4e-75)
10641         self.assertEqual(len(record.rounds[1].alignments[8].hsps), 1)
10642         self.assertEqual(record.rounds[1].alignments[9].hsps[0].score, 709)
10643         self.assertAlmostEqual(record.rounds[1].alignments[9].hsps[0].bits, 280)
10644         self.assertAlmostEqual(record.rounds[1].alignments[9].hsps[0].expect, 8e-75)
10645         self.assertEqual(len(record.rounds[1].alignments[9].hsps), 1)
10646         self.assertEqual(record.rounds[1].alignments[10].hsps[0].score, 687)
10647         self.assertAlmostEqual(record.rounds[1].alignments[10].hsps[0].bits, 272)
10648         self.assertAlmostEqual(record.rounds[1].alignments[10].hsps[0].expect, 3e-72)
10649         self.assertEqual(len(record.rounds[1].alignments[10].hsps), 1)
10650         self.assertEqual(record.rounds[1].alignments[11].hsps[0].score, 684)
10651         self.assertAlmostEqual(record.rounds[1].alignments[11].hsps[0].bits, 270)
10652         self.assertAlmostEqual(record.rounds[1].alignments[11].hsps[0].expect, 6e-72)
10653         self.assertEqual(len(record.rounds[1].alignments[11].hsps), 1)
10654         self.assertEqual(record.rounds[1].alignments[12].hsps[0].score, 633)
10655         self.assertAlmostEqual(record.rounds[1].alignments[12].hsps[0].bits, 251)
10656         self.assertAlmostEqual(record.rounds[1].alignments[12].hsps[0].expect, 6e-66)
10657         self.assertEqual(len(record.rounds[1].alignments[12].hsps), 1)
10658         self.assertEqual(record.rounds[1].alignments[13].hsps[0].score, 566)
10659         self.assertAlmostEqual(record.rounds[1].alignments[13].hsps[0].bits, 224)
10660         self.assertAlmostEqual(record.rounds[1].alignments[13].hsps[0].expect, 4e-58)
10661         self.assertEqual(len(record.rounds[1].alignments[13].hsps), 1)
10662         self.assertEqual(record.rounds[1].alignments[14].hsps[0].score, 216)
10663         self.assertAlmostEqual(record.rounds[1].alignments[14].hsps[0].bits, 88.6)
10664         self.assertAlmostEqual(record.rounds[1].alignments[14].hsps[0].expect, 5e-17)
10665         self.assertEqual(len(record.rounds[1].alignments[14].hsps), 1)
10666         self.assertEqual(record.rounds[1].alignments[15].hsps[0].score, 215)
10667         self.assertAlmostEqual(record.rounds[1].alignments[15].hsps[0].bits, 88.2)
10668         self.assertAlmostEqual(record.rounds[1].alignments[15].hsps[0].expect, 6e-17)
10669         self.assertEqual(len(record.rounds[1].alignments[15].hsps), 1)
10670         self.assertEqual(record.rounds[1].alignments[16].hsps[0].score, 214)
10671         self.assertAlmostEqual(record.rounds[1].alignments[16].hsps[0].bits, 87.8)
10672         self.assertAlmostEqual(record.rounds[1].alignments[16].hsps[0].expect, 8e-17)
10673         self.assertEqual(len(record.rounds[1].alignments[16].hsps), 1)
10674         self.assertEqual(record.rounds[1].alignments[17].hsps[0].score, 161)
10675         self.assertAlmostEqual(record.rounds[1].alignments[17].hsps[0].bits, 67.2)
10676         self.assertAlmostEqual(record.rounds[1].alignments[17].hsps[0].expect, 1e-10)
10677         self.assertEqual(len(record.rounds[1].alignments[17].hsps), 1)
10678         self.assertEqual(record.rounds[1].alignments[18].hsps[0].score, 102)
10679         self.assertAlmostEqual(record.rounds[1].alignments[18].hsps[0].bits, 44.2)
10680         self.assertAlmostEqual(record.rounds[1].alignments[18].hsps[0].expect, 0.001)
10681         self.assertEqual(len(record.rounds[1].alignments[18].hsps), 1)
10682         self.assertEqual(record.rounds[1].alignments[19].hsps[0].score, 99)
10683         self.assertAlmostEqual(record.rounds[1].alignments[19].hsps[0].bits, 43.0)
10684         self.assertAlmostEqual(record.rounds[1].alignments[19].hsps[0].expect, 0.003)
10685         self.assertEqual(len(record.rounds[1].alignments[19].hsps), 1)
10686         self.assertEqual(record.rounds[1].alignments[20].hsps[0].score, 98)
10687         self.assertAlmostEqual(record.rounds[1].alignments[20].hsps[0].bits, 42.6)
10688         self.assertAlmostEqual(record.rounds[1].alignments[20].hsps[0].expect, 0.003)
10689         self.assertEqual(len(record.rounds[1].alignments[20].hsps), 1)
10690         self.assertEqual(record.rounds[1].alignments[21].hsps[0].score, 94)
10691         self.assertAlmostEqual(record.rounds[1].alignments[21].hsps[0].bits, 41.1)
10692         self.assertAlmostEqual(record.rounds[1].alignments[21].hsps[0].expect, 0.010)
10693         self.assertEqual(len(record.rounds[1].alignments[21].hsps), 1)
10694         self.assertEqual(record.rounds[1].alignments[22].hsps[0].score, 74)
10695         self.assertAlmostEqual(record.rounds[1].alignments[22].hsps[0].bits, 33.3)
10696         self.assertAlmostEqual(record.rounds[1].alignments[22].hsps[0].expect, 2.2)
10697         self.assertEqual(len(record.rounds[1].alignments[22].hsps), 1)
10698         self.assertEqual(record.rounds[1].alignments[23].hsps[0].score, 73)
10699         self.assertAlmostEqual(record.rounds[1].alignments[23].hsps[0].bits, 32.9)
10700         self.assertAlmostEqual(record.rounds[1].alignments[23].hsps[0].expect, 2.9)
10701         self.assertEqual(len(record.rounds[1].alignments[23].hsps), 1)
10702         self.assertEqual(record.rounds[1].alignments[24].hsps[0].score, 69)
10703         self.assertAlmostEqual(record.rounds[1].alignments[24].hsps[0].bits, 31.3)
10704         self.assertAlmostEqual(record.rounds[1].alignments[24].hsps[0].expect, 8.4)
10705         self.assertEqual(len(record.rounds[1].alignments[24].hsps), 1)
10706         self.assertEqual(record.rounds[1].alignments[25].hsps[0].score, 69)
10707         self.assertAlmostEqual(record.rounds[1].alignments[25].hsps[0].bits, 31.3)
10708         self.assertAlmostEqual(record.rounds[1].alignments[25].hsps[0].expect, 8.4)
10709         self.assertEqual(record.rounds[2].alignments[0].hsps[0].score, 3143)
10710         self.assertAlmostEqual(record.rounds[2].alignments[0].hsps[0].bits, 1228)
10711         self.assertAlmostEqual(record.rounds[2].alignments[0].hsps[0].expect, 0.0)
10712         self.assertEqual(len(record.rounds[2].alignments[0].hsps), 1)
10713         self.assertEqual(record.rounds[2].alignments[1].hsps[0].score, 1792)
10714         self.assertAlmostEqual(record.rounds[2].alignments[1].hsps[0].bits, 702)
10715         self.assertAlmostEqual(record.rounds[2].alignments[1].hsps[0].expect, 0.0)
10716         self.assertEqual(record.rounds[2].alignments[1].hsps[1].score, 643)
10717         self.assertAlmostEqual(record.rounds[2].alignments[1].hsps[1].bits, 254)
10718         self.assertAlmostEqual(record.rounds[2].alignments[1].hsps[1].expect, 4e-67)
10719         self.assertEqual(len(record.rounds[2].alignments[1].hsps), 2)
10720         self.assertEqual(record.rounds[2].alignments[2].hsps[0].score, 864)
10721         self.assertAlmostEqual(record.rounds[2].alignments[2].hsps[0].bits, 340)
10722         self.assertAlmostEqual(record.rounds[2].alignments[2].hsps[0].expect, 5e-93)
10723         self.assertEqual(len(record.rounds[2].alignments[2].hsps), 1)
10724         self.assertEqual(record.rounds[2].alignments[3].hsps[0].score, 860)
10725         self.assertAlmostEqual(record.rounds[2].alignments[3].hsps[0].bits, 339)
10726         self.assertAlmostEqual(record.rounds[2].alignments[3].hsps[0].expect, 1e-92)
10727         self.assertEqual(len(record.rounds[2].alignments[3].hsps), 1)
10728         self.assertEqual(record.rounds[2].alignments[4].hsps[0].score, 859)
10729         self.assertAlmostEqual(record.rounds[2].alignments[4].hsps[0].bits, 339)
10730         self.assertAlmostEqual(record.rounds[2].alignments[4].hsps[0].expect, 2e-92)
10731         self.assertEqual(len(record.rounds[2].alignments[4].hsps), 1)
10732         self.assertEqual(record.rounds[2].alignments[5].hsps[0].score, 836)
10733         self.assertAlmostEqual(record.rounds[2].alignments[5].hsps[0].bits, 330)
10734         self.assertAlmostEqual(record.rounds[2].alignments[5].hsps[0].expect, 1e-89)
10735         self.assertEqual(len(record.rounds[2].alignments[5].hsps), 1)
10736         self.assertEqual(record.rounds[2].alignments[6].hsps[0].score, 801)
10737         self.assertAlmostEqual(record.rounds[2].alignments[6].hsps[0].bits, 316)
10738         self.assertAlmostEqual(record.rounds[2].alignments[6].hsps[0].expect, 1e-85)
10739         self.assertEqual(len(record.rounds[2].alignments[6].hsps), 1)
10740         self.assertEqual(record.rounds[2].alignments[7].hsps[0].score, 775)
10741         self.assertAlmostEqual(record.rounds[2].alignments[7].hsps[0].bits, 306)
10742         self.assertAlmostEqual(record.rounds[2].alignments[7].hsps[0].expect, 1e-82)
10743         self.assertEqual(len(record.rounds[2].alignments[7].hsps), 1)
10744         self.assertEqual(record.rounds[2].alignments[8].hsps[0].score, 733)
10745         self.assertAlmostEqual(record.rounds[2].alignments[8].hsps[0].bits, 289)
10746         self.assertAlmostEqual(record.rounds[2].alignments[8].hsps[0].expect, 1e-77)
10747         self.assertEqual(len(record.rounds[2].alignments[8].hsps), 1)
10748         self.assertEqual(record.rounds[2].alignments[9].hsps[0].score, 719)
10749         self.assertAlmostEqual(record.rounds[2].alignments[9].hsps[0].bits, 284)
10750         self.assertAlmostEqual(record.rounds[2].alignments[9].hsps[0].expect, 5e-76)
10751         self.assertEqual(len(record.rounds[2].alignments[9].hsps), 1)
10752         self.assertEqual(record.rounds[2].alignments[10].hsps[0].score, 707)
10753         self.assertAlmostEqual(record.rounds[2].alignments[10].hsps[0].bits, 279)
10754         self.assertAlmostEqual(record.rounds[2].alignments[10].hsps[0].expect, 1e-74)
10755         self.assertEqual(len(record.rounds[2].alignments[10].hsps), 1)
10756         self.assertEqual(record.rounds[2].alignments[11].hsps[0].score, 694)
10757         self.assertAlmostEqual(record.rounds[2].alignments[11].hsps[0].bits, 274)
10758         self.assertAlmostEqual(record.rounds[2].alignments[11].hsps[0].expect, 4e-73)
10759         self.assertEqual(len(record.rounds[2].alignments[11].hsps), 1)
10760         self.assertEqual(record.rounds[2].alignments[12].hsps[0].score, 655)
10761         self.assertAlmostEqual(record.rounds[2].alignments[12].hsps[0].bits, 259)
10762         self.assertAlmostEqual(record.rounds[2].alignments[12].hsps[0].expect, 2e-68)
10763         self.assertEqual(len(record.rounds[2].alignments[12].hsps), 1)
10764         self.assertEqual(record.rounds[2].alignments[13].hsps[0].score, 649)
10765         self.assertAlmostEqual(record.rounds[2].alignments[13].hsps[0].bits, 257)
10766         self.assertAlmostEqual(record.rounds[2].alignments[13].hsps[0].expect, 8e-68)
10767         self.assertEqual(len(record.rounds[2].alignments[13].hsps), 1)
10768         self.assertEqual(record.rounds[2].alignments[14].hsps[0].score, 215)
10769         self.assertAlmostEqual(record.rounds[2].alignments[14].hsps[0].bits, 88.2)
10770         self.assertAlmostEqual(record.rounds[2].alignments[14].hsps[0].expect, 6e-17)
10771         self.assertEqual(len(record.rounds[2].alignments[14].hsps), 1)
10772         self.assertEqual(record.rounds[2].alignments[15].hsps[0].score, 213)
10773         self.assertAlmostEqual(record.rounds[2].alignments[15].hsps[0].bits, 87.4)
10774         self.assertAlmostEqual(record.rounds[2].alignments[15].hsps[0].expect, 1e-16)
10775         self.assertEqual(len(record.rounds[2].alignments[15].hsps), 1)
10776         self.assertEqual(record.rounds[2].alignments[16].hsps[0].score, 210)
10777         self.assertAlmostEqual(record.rounds[2].alignments[16].hsps[0].bits, 86.2)
10778         self.assertAlmostEqual(record.rounds[2].alignments[16].hsps[0].expect, 2e-16)
10779         self.assertEqual(len(record.rounds[2].alignments[16].hsps), 1)
10780         self.assertEqual(record.rounds[2].alignments[17].hsps[0].score, 209)
10781         self.assertAlmostEqual(record.rounds[2].alignments[17].hsps[0].bits, 85.9)
10782         self.assertAlmostEqual(record.rounds[2].alignments[17].hsps[0].expect, 3e-16)
10783         self.assertEqual(len(record.rounds[2].alignments[17].hsps), 1)
10784         self.assertEqual(record.rounds[2].alignments[18].hsps[0].score, 111)
10785         self.assertAlmostEqual(record.rounds[2].alignments[18].hsps[0].bits, 47.7)
10786         self.assertAlmostEqual(record.rounds[2].alignments[18].hsps[0].expect, 1e-4)
10787         self.assertEqual(len(record.rounds[2].alignments[18].hsps), 1)
10788         self.assertEqual(record.rounds[2].alignments[19].hsps[0].score, 104)
10789         self.assertAlmostEqual(record.rounds[2].alignments[19].hsps[0].bits, 45.0)
10790         self.assertAlmostEqual(record.rounds[2].alignments[19].hsps[0].expect, 7e-4)
10791         self.assertEqual(len(record.rounds[2].alignments[19].hsps), 1)
10792         self.assertEqual(record.rounds[2].alignments[20].hsps[0].score, 101)
10793         self.assertAlmostEqual(record.rounds[2].alignments[20].hsps[0].bits, 43.8)
10794         self.assertAlmostEqual(record.rounds[2].alignments[20].hsps[0].expect, 0.001)
10795         self.assertEqual(len(record.rounds[2].alignments[20].hsps), 1)
10796         self.assertEqual(record.rounds[2].alignments[21].hsps[0].score, 96)
10797         self.assertAlmostEqual(record.rounds[2].alignments[21].hsps[0].bits, 41.8)
10798         self.assertAlmostEqual(record.rounds[2].alignments[21].hsps[0].expect, 0.006)
10799         self.assertEqual(len(record.rounds[2].alignments[21].hsps), 1)
10800         self.assertEqual(record.rounds[2].alignments[22].hsps[0].score, 73)
10801         self.assertAlmostEqual(record.rounds[2].alignments[22].hsps[0].bits, 32.9)
10802         self.assertAlmostEqual(record.rounds[2].alignments[22].hsps[0].expect, 2.9)
10803         self.assertEqual(len(record.rounds[2].alignments[22].hsps), 1)
10804         self.assertEqual(record.rounds[2].alignments[23].hsps[0].score, 72)
10805         self.assertAlmostEqual(record.rounds[2].alignments[23].hsps[0].bits, 32.5)
10806         self.assertAlmostEqual(record.rounds[2].alignments[23].hsps[0].expect, 3.7)
10807         self.assertEqual(record.rounds[3].alignments[0].hsps[0].score, 3136)
10808         self.assertAlmostEqual(record.rounds[3].alignments[0].hsps[0].bits, 1225)
10809         self.assertAlmostEqual(record.rounds[3].alignments[0].hsps[0].expect, 0.0)
10810         self.assertEqual(len(record.rounds[3].alignments[0].hsps), 1)
10811         self.assertEqual(record.rounds[3].alignments[1].hsps[0].score, 1776)
10812         self.assertAlmostEqual(record.rounds[3].alignments[1].hsps[0].bits, 696)
10813         self.assertAlmostEqual(record.rounds[3].alignments[1].hsps[0].expect, 0.0)
10814         self.assertEqual(record.rounds[3].alignments[1].hsps[1].score, 643)
10815         self.assertAlmostEqual(record.rounds[3].alignments[1].hsps[1].bits, 254)
10816         self.assertAlmostEqual(record.rounds[3].alignments[1].hsps[1].expect, 4e-67)
10817         self.assertEqual(len(record.rounds[3].alignments[1].hsps), 2)
10818         self.assertEqual(record.rounds[3].alignments[2].hsps[0].score, 866)
10819         self.assertAlmostEqual(record.rounds[3].alignments[2].hsps[0].bits, 341)
10820         self.assertAlmostEqual(record.rounds[3].alignments[2].hsps[0].expect, 3e-93)
10821         self.assertEqual(len(record.rounds[3].alignments[2].hsps), 1)
10822         self.assertEqual(record.rounds[3].alignments[3].hsps[0].score, 862)
10823         self.assertAlmostEqual(record.rounds[3].alignments[3].hsps[0].bits, 340)
10824         self.assertAlmostEqual(record.rounds[3].alignments[3].hsps[0].expect, 9e-93)
10825         self.assertEqual(len(record.rounds[3].alignments[3].hsps), 1)
10826         self.assertEqual(record.rounds[3].alignments[4].hsps[0].score, 861)
10827         self.assertAlmostEqual(record.rounds[3].alignments[4].hsps[0].bits, 339)
10828         self.assertAlmostEqual(record.rounds[3].alignments[4].hsps[0].expect, 1e-92)
10829         self.assertEqual(len(record.rounds[3].alignments[4].hsps), 1)
10830         self.assertEqual(record.rounds[3].alignments[5].hsps[0].score, 839)
10831         self.assertAlmostEqual(record.rounds[3].alignments[5].hsps[0].bits, 331)
10832         self.assertAlmostEqual(record.rounds[3].alignments[5].hsps[0].expect, 4e-90)
10833         self.assertEqual(len(record.rounds[3].alignments[5].hsps), 1)
10834         self.assertEqual(record.rounds[3].alignments[6].hsps[0].score, 802)
10835         self.assertAlmostEqual(record.rounds[3].alignments[6].hsps[0].bits, 316)
10836         self.assertAlmostEqual(record.rounds[3].alignments[6].hsps[0].expect, 9e-86)
10837         self.assertEqual(len(record.rounds[3].alignments[6].hsps), 1)
10838         self.assertEqual(record.rounds[3].alignments[7].hsps[0].score, 777)
10839         self.assertAlmostEqual(record.rounds[3].alignments[7].hsps[0].bits, 307)
10840         self.assertAlmostEqual(record.rounds[3].alignments[7].hsps[0].expect, 8e-83)
10841         self.assertEqual(len(record.rounds[3].alignments[7].hsps), 1)
10842         self.assertEqual(record.rounds[3].alignments[8].hsps[0].score, 735)
10843         self.assertAlmostEqual(record.rounds[3].alignments[8].hsps[0].bits, 290)
10844         self.assertAlmostEqual(record.rounds[3].alignments[8].hsps[0].expect, 7e-78)
10845         self.assertEqual(len(record.rounds[3].alignments[8].hsps), 1)
10846         self.assertEqual(record.rounds[3].alignments[9].hsps[0].score, 720)
10847         self.assertAlmostEqual(record.rounds[3].alignments[9].hsps[0].bits, 284)
10848         self.assertAlmostEqual(record.rounds[3].alignments[9].hsps[0].expect, 4e-76)
10849         self.assertEqual(len(record.rounds[3].alignments[9].hsps), 1)
10850         self.assertEqual(record.rounds[3].alignments[10].hsps[0].score, 708)
10851         self.assertAlmostEqual(record.rounds[3].alignments[10].hsps[0].bits, 280)
10852         self.assertAlmostEqual(record.rounds[3].alignments[10].hsps[0].expect, 1e-74)
10853         self.assertEqual(len(record.rounds[3].alignments[10].hsps), 1)
10854         self.assertEqual(record.rounds[3].alignments[11].hsps[0].score, 696)
10855         self.assertAlmostEqual(record.rounds[3].alignments[11].hsps[0].bits, 275)
10856         self.assertAlmostEqual(record.rounds[3].alignments[11].hsps[0].expect, 3e-73)
10857         self.assertEqual(len(record.rounds[3].alignments[11].hsps), 1)
10858         self.assertEqual(record.rounds[3].alignments[12].hsps[0].score, 656)
10859         self.assertAlmostEqual(record.rounds[3].alignments[12].hsps[0].bits, 259)
10860         self.assertAlmostEqual(record.rounds[3].alignments[12].hsps[0].expect, 1e-68)
10861         self.assertEqual(len(record.rounds[3].alignments[12].hsps), 1)
10862         self.assertEqual(record.rounds[3].alignments[13].hsps[0].score, 652)
10863         self.assertAlmostEqual(record.rounds[3].alignments[13].hsps[0].bits, 258)
10864         self.assertAlmostEqual(record.rounds[3].alignments[13].hsps[0].expect, 4e-68)
10865         self.assertEqual(len(record.rounds[3].alignments[13].hsps), 1)
10866         self.assertEqual(record.rounds[3].alignments[14].hsps[0].score, 211)
10867         self.assertAlmostEqual(record.rounds[3].alignments[14].hsps[0].bits, 86.6)
10868         self.assertAlmostEqual(record.rounds[3].alignments[14].hsps[0].expect, 2e-16)
10869         self.assertEqual(len(record.rounds[3].alignments[14].hsps), 1)
10870         self.assertEqual(record.rounds[3].alignments[15].hsps[0].score, 209)
10871         self.assertAlmostEqual(record.rounds[3].alignments[15].hsps[0].bits, 85.9)
10872         self.assertAlmostEqual(record.rounds[3].alignments[15].hsps[0].expect, 3e-16)
10873         self.assertEqual(len(record.rounds[3].alignments[15].hsps), 1)
10874         self.assertEqual(record.rounds[3].alignments[16].hsps[0].score, 208)
10875         self.assertAlmostEqual(record.rounds[3].alignments[16].hsps[0].bits, 85.5)
10876         self.assertAlmostEqual(record.rounds[3].alignments[16].hsps[0].expect, 4e-16)
10877         self.assertEqual(len(record.rounds[3].alignments[16].hsps), 1)
10878         self.assertEqual(record.rounds[3].alignments[17].hsps[0].score, 208)
10879         self.assertAlmostEqual(record.rounds[3].alignments[17].hsps[0].bits, 85.5)
10880         self.assertAlmostEqual(record.rounds[3].alignments[17].hsps[0].expect, 4e-16)
10881         self.assertEqual(len(record.rounds[3].alignments[17].hsps), 1)
10882         self.assertEqual(record.rounds[3].alignments[18].hsps[0].score, 189)
10883         self.assertAlmostEqual(record.rounds[3].alignments[18].hsps[0].bits, 78.1)
10884         self.assertAlmostEqual(record.rounds[3].alignments[18].hsps[0].expect, 7e-14)
10885         self.assertEqual(len(record.rounds[3].alignments[18].hsps), 1)
10886         self.assertEqual(record.rounds[3].alignments[19].hsps[0].score, 158)
10887         self.assertAlmostEqual(record.rounds[3].alignments[19].hsps[0].bits, 66.0)
10888         self.assertAlmostEqual(record.rounds[3].alignments[19].hsps[0].expect, 3e-10)
10889         self.assertEqual(len(record.rounds[3].alignments[19].hsps), 1)
10890         self.assertEqual(record.rounds[3].alignments[20].hsps[0].score, 120)
10891         self.assertAlmostEqual(record.rounds[3].alignments[20].hsps[0].bits, 51.2)
10892         self.assertAlmostEqual(record.rounds[3].alignments[20].hsps[0].expect, 9e-6)
10893         self.assertEqual(len(record.rounds[3].alignments[20].hsps), 1)
10894         self.assertEqual(record.rounds[3].alignments[21].hsps[0].score, 105)
10895         self.assertAlmostEqual(record.rounds[3].alignments[21].hsps[0].bits, 45.3)
10896         self.assertAlmostEqual(record.rounds[3].alignments[21].hsps[0].expect, 5e-4)
10897         self.assertEqual(len(record.rounds[3].alignments[21].hsps), 1)
10898         self.assertEqual(record.rounds[3].alignments[22].hsps[0].score, 73)
10899         self.assertAlmostEqual(record.rounds[3].alignments[22].hsps[0].bits, 32.9)
10900         self.assertAlmostEqual(record.rounds[3].alignments[22].hsps[0].expect, 2.9)
10901         self.assertEqual(len(record.rounds[3].alignments[22].hsps), 1)
10902         self.assertEqual(record.rounds[3].alignments[23].hsps[0].score, 73)
10903         self.assertAlmostEqual(record.rounds[3].alignments[23].hsps[0].bits, 32.9)
10904         self.assertAlmostEqual(record.rounds[3].alignments[23].hsps[0].expect, 2.9)
10905         self.assertEqual(record.rounds[4].alignments[0].hsps[0].score, 3106)
10906         self.assertAlmostEqual(record.rounds[4].alignments[0].hsps[0].bits, 1214)
10907         self.assertAlmostEqual(record.rounds[4].alignments[0].hsps[0].expect, 0.0)
10908         self.assertEqual(len(record.rounds[4].alignments[0].hsps), 1)
10909         self.assertEqual(record.rounds[4].alignments[1].hsps[0].score, 1758)
10910         self.assertAlmostEqual(record.rounds[4].alignments[1].hsps[0].bits, 689)
10911         self.assertAlmostEqual(record.rounds[4].alignments[1].hsps[0].expect, 0.0)
10912         self.assertEqual(record.rounds[4].alignments[1].hsps[1].score, 644)
10913         self.assertAlmostEqual(record.rounds[4].alignments[1].hsps[1].bits, 255)
10914         self.assertAlmostEqual(record.rounds[4].alignments[1].hsps[1].expect, 3e-67)
10915         self.assertEqual(len(record.rounds[4].alignments[1].hsps), 2)
10916         self.assertEqual(record.rounds[4].alignments[2].hsps[0].score, 867)
10917         self.assertAlmostEqual(record.rounds[4].alignments[2].hsps[0].bits, 342)
10918         self.assertAlmostEqual(record.rounds[4].alignments[2].hsps[0].expect, 2e-93)
10919         self.assertEqual(len(record.rounds[4].alignments[2].hsps), 1)
10920         self.assertEqual(record.rounds[4].alignments[3].hsps[0].score, 865)
10921         self.assertAlmostEqual(record.rounds[4].alignments[3].hsps[0].bits, 341)
10922         self.assertAlmostEqual(record.rounds[4].alignments[3].hsps[0].expect, 4e-93)
10923         self.assertEqual(len(record.rounds[4].alignments[3].hsps), 1)
10924         self.assertEqual(record.rounds[4].alignments[4].hsps[0].score, 864)
10925         self.assertAlmostEqual(record.rounds[4].alignments[4].hsps[0].bits, 340)
10926         self.assertAlmostEqual(record.rounds[4].alignments[4].hsps[0].expect, 5e-93)
10927         self.assertEqual(len(record.rounds[4].alignments[4].hsps), 1)
10928         self.assertEqual(record.rounds[4].alignments[5].hsps[0].score, 840)
10929         self.assertAlmostEqual(record.rounds[4].alignments[5].hsps[0].bits, 331)
10930         self.assertAlmostEqual(record.rounds[4].alignments[5].hsps[0].expect, 3e-90)
10931         self.assertEqual(len(record.rounds[4].alignments[5].hsps), 1)
10932         self.assertEqual(record.rounds[4].alignments[6].hsps[0].score, 802)
10933         self.assertAlmostEqual(record.rounds[4].alignments[6].hsps[0].bits, 316)
10934         self.assertAlmostEqual(record.rounds[4].alignments[6].hsps[0].expect, 9e-86)
10935         self.assertEqual(len(record.rounds[4].alignments[6].hsps), 1)
10936         self.assertEqual(record.rounds[4].alignments[7].hsps[0].score, 777)
10937         self.assertAlmostEqual(record.rounds[4].alignments[7].hsps[0].bits, 307)
10938         self.assertAlmostEqual(record.rounds[4].alignments[7].hsps[0].expect, 8e-83)
10939         self.assertEqual(len(record.rounds[4].alignments[7].hsps), 1)
10940         self.assertEqual(record.rounds[4].alignments[8].hsps[0].score, 735)
10941         self.assertAlmostEqual(record.rounds[4].alignments[8].hsps[0].bits, 290)
10942         self.assertAlmostEqual(record.rounds[4].alignments[8].hsps[0].expect, 7e-78)
10943         self.assertEqual(len(record.rounds[4].alignments[8].hsps), 1)
10944         self.assertEqual(record.rounds[4].alignments[9].hsps[0].score, 720)
10945         self.assertAlmostEqual(record.rounds[4].alignments[9].hsps[0].bits, 284)
10946         self.assertAlmostEqual(record.rounds[4].alignments[9].hsps[0].expect, 4e-76)
10947         self.assertEqual(len(record.rounds[4].alignments[9].hsps), 1)
10948         self.assertEqual(record.rounds[4].alignments[10].hsps[0].score, 709)
10949         self.assertAlmostEqual(record.rounds[4].alignments[10].hsps[0].bits, 280)
10950         self.assertAlmostEqual(record.rounds[4].alignments[10].hsps[0].expect, 8e-75)
10951         self.assertEqual(len(record.rounds[4].alignments[10].hsps), 1)
10952         self.assertEqual(record.rounds[4].alignments[11].hsps[0].score, 697)
10953         self.assertAlmostEqual(record.rounds[4].alignments[11].hsps[0].bits, 275)
10954         self.assertAlmostEqual(record.rounds[4].alignments[11].hsps[0].expect, 2e-73)
10955         self.assertEqual(len(record.rounds[4].alignments[11].hsps), 1)
10956         self.assertEqual(record.rounds[4].alignments[12].hsps[0].score, 657)
10957         self.assertAlmostEqual(record.rounds[4].alignments[12].hsps[0].bits, 260)
10958         self.assertAlmostEqual(record.rounds[4].alignments[12].hsps[0].expect, 9e-69)
10959         self.assertEqual(len(record.rounds[4].alignments[12].hsps), 1)
10960         self.assertEqual(record.rounds[4].alignments[13].hsps[0].score, 651)
10961         self.assertAlmostEqual(record.rounds[4].alignments[13].hsps[0].bits, 258)
10962         self.assertAlmostEqual(record.rounds[4].alignments[13].hsps[0].expect, 5e-68)
10963         self.assertEqual(len(record.rounds[4].alignments[13].hsps), 1)
10964         self.assertEqual(record.rounds[4].alignments[14].hsps[0].score, 196)
10965         self.assertAlmostEqual(record.rounds[4].alignments[14].hsps[0].bits, 80.8)
10966         self.assertAlmostEqual(record.rounds[4].alignments[14].hsps[0].expect, 1e-14)
10967         self.assertEqual(len(record.rounds[4].alignments[14].hsps), 1)
10968         self.assertEqual(record.rounds[4].alignments[15].hsps[0].score, 194)
10969         self.assertAlmostEqual(record.rounds[4].alignments[15].hsps[0].bits, 80.0)
10970         self.assertAlmostEqual(record.rounds[4].alignments[15].hsps[0].expect, 2e-14)
10971         self.assertEqual(len(record.rounds[4].alignments[15].hsps), 1)
10972         self.assertEqual(record.rounds[4].alignments[16].hsps[0].score, 192)
10973         self.assertAlmostEqual(record.rounds[4].alignments[16].hsps[0].bits, 79.2)
10974         self.assertAlmostEqual(record.rounds[4].alignments[16].hsps[0].expect, 3e-14)
10975         self.assertEqual(len(record.rounds[4].alignments[16].hsps), 1)
10976         self.assertEqual(record.rounds[4].alignments[17].hsps[0].score, 190)
10977         self.assertAlmostEqual(record.rounds[4].alignments[17].hsps[0].bits, 78.5)
10978         self.assertAlmostEqual(record.rounds[4].alignments[17].hsps[0].expect, 5e-14)
10979         self.assertEqual(len(record.rounds[4].alignments[17].hsps), 1)
10980         self.assertEqual(record.rounds[4].alignments[18].hsps[0].score, 168)
10981         self.assertAlmostEqual(record.rounds[4].alignments[18].hsps[0].bits, 69.9)
10982         self.assertAlmostEqual(record.rounds[4].alignments[18].hsps[0].expect, 2e-11)
10983         self.assertEqual(len(record.rounds[4].alignments[18].hsps), 1)
10984         self.assertEqual(record.rounds[4].alignments[19].hsps[0].score, 155)
10985         self.assertAlmostEqual(record.rounds[4].alignments[19].hsps[0].bits, 64.8)
10986         self.assertAlmostEqual(record.rounds[4].alignments[19].hsps[0].expect, 7e-10)
10987         self.assertEqual(len(record.rounds[4].alignments[19].hsps), 1)
10988         self.assertEqual(record.rounds[4].alignments[20].hsps[0].score, 154)
10989         self.assertAlmostEqual(record.rounds[4].alignments[20].hsps[0].bits, 64.4)
10990         self.assertAlmostEqual(record.rounds[4].alignments[20].hsps[0].expect, 9e-10)
10991         self.assertEqual(len(record.rounds[4].alignments[20].hsps), 1)
10992         self.assertEqual(record.rounds[4].alignments[21].hsps[0].score, 137)
10993         self.assertAlmostEqual(record.rounds[4].alignments[21].hsps[0].bits, 57.8)
10994         self.assertAlmostEqual(record.rounds[4].alignments[21].hsps[0].expect, 9e-8)
10995         self.assertEqual(len(record.rounds[4].alignments[21].hsps), 1)
10996         self.assertEqual(record.rounds[4].alignments[22].hsps[0].score, 74)
10997         self.assertAlmostEqual(record.rounds[4].alignments[22].hsps[0].bits, 33.3)
10998         self.assertAlmostEqual(record.rounds[4].alignments[22].hsps[0].expect, 2.2)
10999         self.assertEqual(len(record.rounds[4].alignments[22].hsps), 1)
11000         self.assertEqual(record.rounds[4].alignments[23].hsps[0].score, 73)
11001         self.assertAlmostEqual(record.rounds[4].alignments[23].hsps[0].bits, 32.9)
11002         self.assertAlmostEqual(record.rounds[4].alignments[23].hsps[0].expect, 2.9)
11003         self.assertEqual(len(record.rounds[4].alignments[23].hsps), 1)

Here is the caller graph for this function:

Definition at line 11004 of file test_NCBITextParser.py.

11004 
11005     def _check_bt060_hsps_counts(self, record):
11006         self.assertEqual(record.rounds[0].alignments[0].hsps[0].identities, (765, 889))
11007         self.assertEqual(record.rounds[0].alignments[0].hsps[0].positives, (765, 889))
11008         self.assertEqual(record.rounds[0].alignments[1].hsps[0].identities, (281, 634))
11009         self.assertEqual(record.rounds[0].alignments[1].hsps[0].positives, (375, 634))
11010         self.assertEqual(record.rounds[0].alignments[1].hsps[0].gaps, (32, 634))
11011         self.assertEqual(record.rounds[0].alignments[1].hsps[1].identities, (69, 209))
11012         self.assertEqual(record.rounds[0].alignments[1].hsps[1].positives, (107, 209))
11013         self.assertEqual(record.rounds[0].alignments[1].hsps[1].gaps, (26, 209))
11014         self.assertEqual(record.rounds[0].alignments[2].hsps[0].identities, (69, 267))
11015         self.assertEqual(record.rounds[0].alignments[2].hsps[0].positives, (116, 267))
11016         self.assertEqual(record.rounds[0].alignments[2].hsps[0].gaps, (22, 267))
11017         self.assertEqual(record.rounds[0].alignments[3].hsps[0].identities, (71, 267))
11018         self.assertEqual(record.rounds[0].alignments[3].hsps[0].positives, (122, 267))
11019         self.assertEqual(record.rounds[0].alignments[3].hsps[0].gaps, (22, 267))
11020         self.assertEqual(record.rounds[0].alignments[4].hsps[0].identities, (72, 268))
11021         self.assertEqual(record.rounds[0].alignments[4].hsps[0].positives, (122, 268))
11022         self.assertEqual(record.rounds[0].alignments[4].hsps[0].gaps, (23, 268))
11023         self.assertEqual(record.rounds[0].alignments[5].hsps[0].identities, (73, 270))
11024         self.assertEqual(record.rounds[0].alignments[5].hsps[0].positives, (120, 270))
11025         self.assertEqual(record.rounds[0].alignments[5].hsps[0].gaps, (27, 270))
11026         self.assertEqual(record.rounds[0].alignments[6].hsps[0].identities, (65, 250))
11027         self.assertEqual(record.rounds[0].alignments[6].hsps[0].positives, (110, 250))
11028         self.assertEqual(record.rounds[0].alignments[6].hsps[0].gaps, (19, 250))
11029         self.assertEqual(record.rounds[0].alignments[7].hsps[0].identities, (68, 249))
11030         self.assertEqual(record.rounds[0].alignments[7].hsps[0].positives, (117, 249))
11031         self.assertEqual(record.rounds[0].alignments[7].hsps[0].gaps, (12, 249))
11032         self.assertEqual(record.rounds[0].alignments[8].hsps[0].identities, (67, 252))
11033         self.assertEqual(record.rounds[0].alignments[8].hsps[0].positives, (125, 252))
11034         self.assertEqual(record.rounds[0].alignments[8].hsps[0].gaps, (21, 252))
11035         self.assertEqual(record.rounds[0].alignments[9].hsps[0].identities, (67, 243))
11036         self.assertEqual(record.rounds[0].alignments[9].hsps[0].positives, (114, 243))
11037         self.assertEqual(record.rounds[0].alignments[9].hsps[0].gaps, (12, 243))
11038         self.assertEqual(record.rounds[0].alignments[10].hsps[0].identities, (58, 264))
11039         self.assertEqual(record.rounds[0].alignments[10].hsps[0].positives, (114, 264))
11040         self.assertEqual(record.rounds[0].alignments[10].hsps[0].gaps, (16, 264))
11041         self.assertEqual(record.rounds[0].alignments[11].hsps[0].identities, (51, 210))
11042         self.assertEqual(record.rounds[0].alignments[11].hsps[0].positives, (92, 210))
11043         self.assertEqual(record.rounds[0].alignments[11].hsps[0].gaps, (17, 210))
11044         self.assertEqual(record.rounds[0].alignments[12].hsps[0].identities, (60, 255))
11045         self.assertEqual(record.rounds[0].alignments[12].hsps[0].positives, (97, 255))
11046         self.assertEqual(record.rounds[0].alignments[12].hsps[0].gaps, (21, 255))
11047         self.assertEqual(record.rounds[0].alignments[13].hsps[0].identities, (63, 289))
11048         self.assertEqual(record.rounds[0].alignments[13].hsps[0].positives, (116, 289))
11049         self.assertEqual(record.rounds[0].alignments[13].hsps[0].gaps, (34, 289))
11050         self.assertEqual(record.rounds[0].alignments[14].hsps[0].identities, (25, 70))
11051         self.assertEqual(record.rounds[0].alignments[14].hsps[0].positives, (36, 70))
11052         self.assertEqual(record.rounds[0].alignments[15].hsps[0].identities, (25, 70))
11053         self.assertEqual(record.rounds[0].alignments[15].hsps[0].positives, (35, 70))
11054         self.assertEqual(record.rounds[0].alignments[16].hsps[0].identities, (25, 70))
11055         self.assertEqual(record.rounds[0].alignments[16].hsps[0].positives, (34, 70))
11056         self.assertEqual(record.rounds[0].alignments[17].hsps[0].identities, (21, 59))
11057         self.assertEqual(record.rounds[0].alignments[17].hsps[0].positives, (29, 59))
11058         self.assertEqual(record.rounds[0].alignments[18].hsps[0].identities, (17, 57))
11059         self.assertEqual(record.rounds[0].alignments[18].hsps[0].positives, (29, 57))
11060         self.assertEqual(record.rounds[0].alignments[19].hsps[0].identities, (18, 56))
11061         self.assertEqual(record.rounds[0].alignments[19].hsps[0].positives, (28, 56))
11062         self.assertEqual(record.rounds[0].alignments[20].hsps[0].identities, (23, 87))
11063         self.assertEqual(record.rounds[0].alignments[20].hsps[0].positives, (38, 87))
11064         self.assertEqual(record.rounds[0].alignments[20].hsps[0].gaps, (1, 87))
11065         self.assertEqual(record.rounds[0].alignments[21].hsps[0].identities, (18, 61))
11066         self.assertEqual(record.rounds[0].alignments[21].hsps[0].positives, (26, 61))
11067         self.assertEqual(record.rounds[0].alignments[22].hsps[0].identities, (29, 99))
11068         self.assertEqual(record.rounds[0].alignments[22].hsps[0].positives, (40, 99))
11069         self.assertEqual(record.rounds[0].alignments[22].hsps[0].gaps, (14, 99))
11070         self.assertEqual(record.rounds[0].alignments[23].hsps[0].identities, (26, 100))
11071         self.assertEqual(record.rounds[0].alignments[23].hsps[0].positives, (46, 100))
11072         self.assertEqual(record.rounds[0].alignments[23].hsps[0].gaps, (3, 100))
11073         self.assertEqual(record.rounds[0].alignments[24].hsps[0].identities, (23, 90))
11074         self.assertEqual(record.rounds[0].alignments[24].hsps[0].positives, (44, 90))
11075         self.assertEqual(record.rounds[0].alignments[24].hsps[0].gaps, (10, 90))
11076         self.assertEqual(record.rounds[0].alignments[25].hsps[0].identities, (22, 74))
11077         self.assertEqual(record.rounds[0].alignments[25].hsps[0].positives, (39, 74))
11078         self.assertEqual(record.rounds[0].alignments[25].hsps[0].gaps, (10, 74))
11079         self.assertEqual(record.rounds[0].alignments[26].hsps[0].identities, (24, 78))
11080         self.assertEqual(record.rounds[0].alignments[26].hsps[0].positives, (35, 78))
11081         self.assertEqual(record.rounds[0].alignments[26].hsps[0].gaps, (8, 78))
11082         self.assertEqual(record.rounds[1].alignments[0].hsps[0].identities, (765, 889))
11083         self.assertEqual(record.rounds[1].alignments[0].hsps[0].positives, (765, 889))
11084         self.assertEqual(record.rounds[1].alignments[1].hsps[0].identities, (281, 635))
11085         self.assertEqual(record.rounds[1].alignments[1].hsps[0].positives, (374, 635))
11086         self.assertEqual(record.rounds[1].alignments[1].hsps[0].gaps, (34, 635))
11087         self.assertEqual(record.rounds[1].alignments[1].hsps[1].identities, (69, 209))
11088         self.assertEqual(record.rounds[1].alignments[1].hsps[1].positives, (107, 209))
11089         self.assertEqual(record.rounds[1].alignments[1].hsps[1].gaps, (26, 209))
11090         self.assertEqual(record.rounds[1].alignments[2].hsps[0].identities, (72, 268))
11091         self.assertEqual(record.rounds[1].alignments[2].hsps[0].positives, (119, 268))
11092         self.assertEqual(record.rounds[1].alignments[2].hsps[0].gaps, (23, 268))
11093         self.assertEqual(record.rounds[1].alignments[3].hsps[0].identities, (69, 265))
11094         self.assertEqual(record.rounds[1].alignments[3].hsps[0].positives, (115, 265))
11095         self.assertEqual(record.rounds[1].alignments[3].hsps[0].gaps, (18, 265))
11096         self.assertEqual(record.rounds[1].alignments[4].hsps[0].identities, (72, 268))
11097         self.assertEqual(record.rounds[1].alignments[4].hsps[0].positives, (117, 268))
11098         self.assertEqual(record.rounds[1].alignments[4].hsps[0].gaps, (23, 268))
11099         self.assertEqual(record.rounds[1].alignments[5].hsps[0].identities, (69, 265))
11100         self.assertEqual(record.rounds[1].alignments[5].hsps[0].positives, (116, 265))
11101         self.assertEqual(record.rounds[1].alignments[5].hsps[0].gaps, (18, 265))
11102         self.assertEqual(record.rounds[1].alignments[6].hsps[0].identities, (67, 249))
11103         self.assertEqual(record.rounds[1].alignments[6].hsps[0].positives, (116, 249))
11104         self.assertEqual(record.rounds[1].alignments[6].hsps[0].gaps, (12, 249))
11105         self.assertEqual(record.rounds[1].alignments[7].hsps[0].identities, (67, 249))
11106         self.assertEqual(record.rounds[1].alignments[7].hsps[0].positives, (115, 249))
11107         self.assertEqual(record.rounds[1].alignments[7].hsps[0].gaps, (13, 249))
11108         self.assertEqual(record.rounds[1].alignments[8].hsps[0].identities, (58, 271))
11109         self.assertEqual(record.rounds[1].alignments[8].hsps[0].positives, (116, 271))
11110         self.assertEqual(record.rounds[1].alignments[8].hsps[0].gaps, (16, 271))
11111         self.assertEqual(record.rounds[1].alignments[9].hsps[0].identities, (65, 250))
11112         self.assertEqual(record.rounds[1].alignments[9].hsps[0].positives, (109, 250))
11113         self.assertEqual(record.rounds[1].alignments[9].hsps[0].gaps, (19, 250))
11114         self.assertEqual(record.rounds[1].alignments[10].hsps[0].identities, (58, 286))
11115         self.assertEqual(record.rounds[1].alignments[10].hsps[0].positives, (109, 286))
11116         self.assertEqual(record.rounds[1].alignments[10].hsps[0].gaps, (28, 286))
11117         self.assertEqual(record.rounds[1].alignments[11].hsps[0].identities, (58, 256))
11118         self.assertEqual(record.rounds[1].alignments[11].hsps[0].positives, (96, 256))
11119         self.assertEqual(record.rounds[1].alignments[11].hsps[0].gaps, (15, 256))
11120         self.assertEqual(record.rounds[1].alignments[12].hsps[0].identities, (68, 259))
11121         self.assertEqual(record.rounds[1].alignments[12].hsps[0].positives, (126, 259))
11122         self.assertEqual(record.rounds[1].alignments[12].hsps[0].gaps, (21, 259))
11123         self.assertEqual(record.rounds[1].alignments[13].hsps[0].identities, (60, 277))
11124         self.assertEqual(record.rounds[1].alignments[13].hsps[0].positives, (109, 277))
11125         self.assertEqual(record.rounds[1].alignments[13].hsps[0].gaps, (29, 277))
11126         self.assertEqual(record.rounds[1].alignments[14].hsps[0].identities, (25, 70))
11127         self.assertEqual(record.rounds[1].alignments[14].hsps[0].positives, (35, 70))
11128         self.assertEqual(record.rounds[1].alignments[15].hsps[0].identities, (25, 70))
11129         self.assertEqual(record.rounds[1].alignments[15].hsps[0].positives, (34, 70))
11130         self.assertEqual(record.rounds[1].alignments[16].hsps[0].identities, (25, 70))
11131         self.assertEqual(record.rounds[1].alignments[16].hsps[0].positives, (36, 70))
11132         self.assertEqual(record.rounds[1].alignments[17].hsps[0].identities, (22, 72))
11133         self.assertEqual(record.rounds[1].alignments[17].hsps[0].positives, (30, 72))
11134         self.assertEqual(record.rounds[1].alignments[18].hsps[0].identities, (18, 62))
11135         self.assertEqual(record.rounds[1].alignments[18].hsps[0].positives, (26, 62))
11136         self.assertEqual(record.rounds[1].alignments[19].hsps[0].identities, (18, 63))
11137         self.assertEqual(record.rounds[1].alignments[19].hsps[0].positives, (28, 63))
11138         self.assertEqual(record.rounds[1].alignments[20].hsps[0].identities, (17, 60))
11139         self.assertEqual(record.rounds[1].alignments[20].hsps[0].positives, (29, 60))
11140         self.assertEqual(record.rounds[1].alignments[21].hsps[0].identities, (20, 49))
11141         self.assertEqual(record.rounds[1].alignments[21].hsps[0].positives, (23, 49))
11142         self.assertEqual(record.rounds[1].alignments[21].hsps[0].gaps, (6, 49))
11143         self.assertEqual(record.rounds[1].alignments[22].hsps[0].identities, (17, 92))
11144         self.assertEqual(record.rounds[1].alignments[22].hsps[0].positives, (25, 92))
11145         self.assertEqual(record.rounds[1].alignments[22].hsps[0].gaps, (13, 92))
11146         self.assertEqual(record.rounds[1].alignments[23].hsps[0].identities, (22, 95))
11147         self.assertEqual(record.rounds[1].alignments[23].hsps[0].positives, (35, 95))
11148         self.assertEqual(record.rounds[1].alignments[24].hsps[0].identities, (26, 238))
11149         self.assertEqual(record.rounds[1].alignments[24].hsps[0].positives, (59, 238))
11150         self.assertEqual(record.rounds[1].alignments[24].hsps[0].gaps, (45, 238))
11151         self.assertEqual(record.rounds[1].alignments[25].hsps[0].identities, (20, 117))
11152         self.assertEqual(record.rounds[1].alignments[25].hsps[0].positives, (44, 117))
11153         self.assertEqual(record.rounds[1].alignments[25].hsps[0].gaps, (18, 117))
11154         self.assertEqual(record.rounds[2].alignments[0].hsps[0].identities, (765, 889))
11155         self.assertEqual(record.rounds[2].alignments[0].hsps[0].positives, (765, 889))
11156         self.assertEqual(record.rounds[2].alignments[1].hsps[0].identities, (281, 635))
11157         self.assertEqual(record.rounds[2].alignments[1].hsps[0].positives, (374, 635))
11158         self.assertEqual(record.rounds[2].alignments[1].hsps[0].gaps, (34, 635))
11159         self.assertEqual(record.rounds[2].alignments[1].hsps[1].identities, (69, 209))
11160         self.assertEqual(record.rounds[2].alignments[1].hsps[1].positives, (107, 209))
11161         self.assertEqual(record.rounds[2].alignments[1].hsps[1].gaps, (26, 209))
11162         self.assertEqual(record.rounds[2].alignments[2].hsps[0].identities, (69, 265))
11163         self.assertEqual(record.rounds[2].alignments[2].hsps[0].positives, (115, 265))
11164         self.assertEqual(record.rounds[2].alignments[2].hsps[0].gaps, (18, 265))
11165         self.assertEqual(record.rounds[2].alignments[3].hsps[0].identities, (72, 268))
11166         self.assertEqual(record.rounds[2].alignments[3].hsps[0].positives, (119, 268))
11167         self.assertEqual(record.rounds[2].alignments[3].hsps[0].gaps, (23, 268))
11168         self.assertEqual(record.rounds[2].alignments[4].hsps[0].identities, (72, 268))
11169         self.assertEqual(record.rounds[2].alignments[4].hsps[0].positives, (117, 268))
11170         self.assertEqual(record.rounds[2].alignments[4].hsps[0].gaps, (23, 268))
11171         self.assertEqual(record.rounds[2].alignments[5].hsps[0].identities, (69, 265))
11172         self.assertEqual(record.rounds[2].alignments[5].hsps[0].positives, (116, 265))
11173         self.assertEqual(record.rounds[2].alignments[5].hsps[0].gaps, (18, 265))
11174         self.assertEqual(record.rounds[2].alignments[6].hsps[0].identities, (67, 249))
11175         self.assertEqual(record.rounds[2].alignments[6].hsps[0].positives, (116, 249))
11176         self.assertEqual(record.rounds[2].alignments[6].hsps[0].gaps, (12, 249))
11177         self.assertEqual(record.rounds[2].alignments[7].hsps[0].identities, (67, 249))
11178         self.assertEqual(record.rounds[2].alignments[7].hsps[0].positives, (114, 249))
11179         self.assertEqual(record.rounds[2].alignments[7].hsps[0].gaps, (13, 249))
11180         self.assertEqual(record.rounds[2].alignments[8].hsps[0].identities, (58, 271))
11181         self.assertEqual(record.rounds[2].alignments[8].hsps[0].positives, (116, 271))
11182         self.assertEqual(record.rounds[2].alignments[8].hsps[0].gaps, (16, 271))
11183         self.assertEqual(record.rounds[2].alignments[9].hsps[0].identities, (58, 286))
11184         self.assertEqual(record.rounds[2].alignments[9].hsps[0].positives, (109, 286))
11185         self.assertEqual(record.rounds[2].alignments[9].hsps[0].gaps, (28, 286))
11186         self.assertEqual(record.rounds[2].alignments[10].hsps[0].identities, (65, 250))
11187         self.assertEqual(record.rounds[2].alignments[10].hsps[0].positives, (109, 250))
11188         self.assertEqual(record.rounds[2].alignments[10].hsps[0].gaps, (19, 250))
11189         self.assertEqual(record.rounds[2].alignments[11].hsps[0].identities, (58, 256))
11190         self.assertEqual(record.rounds[2].alignments[11].hsps[0].positives, (96, 256))
11191         self.assertEqual(record.rounds[2].alignments[11].hsps[0].gaps, (15, 256))
11192         self.assertEqual(record.rounds[2].alignments[12].hsps[0].identities, (60, 277))
11193         self.assertEqual(record.rounds[2].alignments[12].hsps[0].positives, (109, 277))
11194         self.assertEqual(record.rounds[2].alignments[12].hsps[0].gaps, (29, 277))
11195         self.assertEqual(record.rounds[2].alignments[13].hsps[0].identities, (68, 259))
11196         self.assertEqual(record.rounds[2].alignments[13].hsps[0].positives, (125, 259))
11197         self.assertEqual(record.rounds[2].alignments[13].hsps[0].gaps, (21, 259))
11198         self.assertEqual(record.rounds[2].alignments[14].hsps[0].identities, (22, 72))
11199         self.assertEqual(record.rounds[2].alignments[14].hsps[0].positives, (30, 72))
11200         self.assertEqual(record.rounds[2].alignments[15].hsps[0].identities, (25, 71))
11201         self.assertEqual(record.rounds[2].alignments[15].hsps[0].positives, (35, 71))
11202         self.assertEqual(record.rounds[2].alignments[16].hsps[0].identities, (25, 71))
11203         self.assertEqual(record.rounds[2].alignments[16].hsps[0].positives, (34, 71))
11204         self.assertEqual(record.rounds[2].alignments[17].hsps[0].identities, (25, 71))
11205         self.assertEqual(record.rounds[2].alignments[17].hsps[0].positives, (36, 71))
11206         self.assertEqual(record.rounds[2].alignments[18].hsps[0].identities, (18, 63))
11207         self.assertEqual(record.rounds[2].alignments[18].hsps[0].positives, (28, 63))
11208         self.assertEqual(record.rounds[2].alignments[19].hsps[0].identities, (22, 80))
11209         self.assertEqual(record.rounds[2].alignments[19].hsps[0].positives, (30, 80))
11210         self.assertEqual(record.rounds[2].alignments[19].hsps[0].gaps, (6, 80))
11211         self.assertEqual(record.rounds[2].alignments[20].hsps[0].identities, (17, 62))
11212         self.assertEqual(record.rounds[2].alignments[20].hsps[0].positives, (29, 62))
11213         self.assertEqual(record.rounds[2].alignments[21].hsps[0].identities, (20, 49))
11214         self.assertEqual(record.rounds[2].alignments[21].hsps[0].positives, (23, 49))
11215         self.assertEqual(record.rounds[2].alignments[21].hsps[0].gaps, (6, 49))
11216         self.assertEqual(record.rounds[2].alignments[22].hsps[0].identities, (22, 95))
11217         self.assertEqual(record.rounds[2].alignments[22].hsps[0].positives, (35, 95))
11218         self.assertEqual(record.rounds[2].alignments[23].hsps[0].identities, (17, 92))
11219         self.assertEqual(record.rounds[2].alignments[23].hsps[0].positives, (25, 92))
11220         self.assertEqual(record.rounds[2].alignments[23].hsps[0].gaps, (13, 92))
11221         self.assertEqual(record.rounds[3].alignments[0].hsps[0].identities, (765, 889))
11222         self.assertEqual(record.rounds[3].alignments[0].hsps[0].positives, (765, 889))
11223         self.assertEqual(record.rounds[3].alignments[1].hsps[0].identities, (281, 635))
11224         self.assertEqual(record.rounds[3].alignments[1].hsps[0].positives, (374, 635))
11225         self.assertEqual(record.rounds[3].alignments[1].hsps[0].gaps, (34, 635))
11226         self.assertEqual(record.rounds[3].alignments[1].hsps[1].identities, (69, 209))
11227         self.assertEqual(record.rounds[3].alignments[1].hsps[1].positives, (107, 209))
11228         self.assertEqual(record.rounds[3].alignments[1].hsps[1].gaps, (26, 209))
11229         self.assertEqual(record.rounds[3].alignments[2].hsps[0].identities, (69, 265))
11230         self.assertEqual(record.rounds[3].alignments[2].hsps[0].positives, (115, 265))
11231         self.assertEqual(record.rounds[3].alignments[2].hsps[0].gaps, (18, 265))
11232         self.assertEqual(record.rounds[3].alignments[3].hsps[0].identities, (71, 268))
11233         self.assertEqual(record.rounds[3].alignments[3].hsps[0].positives, (119, 268))
11234         self.assertEqual(record.rounds[3].alignments[3].hsps[0].gaps, (23, 268))
11235         self.assertEqual(record.rounds[3].alignments[4].hsps[0].identities, (71, 268))
11236         self.assertEqual(record.rounds[3].alignments[4].hsps[0].positives, (117, 268))
11237         self.assertEqual(record.rounds[3].alignments[4].hsps[0].gaps, (23, 268))
11238         self.assertEqual(record.rounds[3].alignments[5].hsps[0].identities, (69, 265))
11239         self.assertEqual(record.rounds[3].alignments[5].hsps[0].positives, (116, 265))
11240         self.assertEqual(record.rounds[3].alignments[5].hsps[0].gaps, (18, 265))
11241         self.assertEqual(record.rounds[3].alignments[6].hsps[0].identities, (67, 249))
11242         self.assertEqual(record.rounds[3].alignments[6].hsps[0].positives, (116, 249))
11243         self.assertEqual(record.rounds[3].alignments[6].hsps[0].gaps, (12, 249))
11244         self.assertEqual(record.rounds[3].alignments[7].hsps[0].identities, (67, 249))
11245         self.assertEqual(record.rounds[3].alignments[7].hsps[0].positives, (114, 249))
11246         self.assertEqual(record.rounds[3].alignments[7].hsps[0].gaps, (13, 249))
11247         self.assertEqual(record.rounds[3].alignments[8].hsps[0].identities, (58, 271))
11248         self.assertEqual(record.rounds[3].alignments[8].hsps[0].positives, (116, 271))
11249         self.assertEqual(record.rounds[3].alignments[8].hsps[0].gaps, (16, 271))
11250         self.assertEqual(record.rounds[3].alignments[9].hsps[0].identities, (58, 286))
11251         self.assertEqual(record.rounds[3].alignments[9].hsps[0].positives, (109, 286))
11252         self.assertEqual(record.rounds[3].alignments[9].hsps[0].gaps, (28, 286))
11253         self.assertEqual(record.rounds[3].alignments[10].hsps[0].identities, (65, 250))
11254         self.assertEqual(record.rounds[3].alignments[10].hsps[0].positives, (109, 250))
11255         self.assertEqual(record.rounds[3].alignments[10].hsps[0].gaps, (19, 250))
11256         self.assertEqual(record.rounds[3].alignments[11].hsps[0].identities, (58, 256))
11257         self.assertEqual(record.rounds[3].alignments[11].hsps[0].positives, (96, 256))
11258         self.assertEqual(record.rounds[3].alignments[11].hsps[0].gaps, (15, 256))
11259         self.assertEqual(record.rounds[3].alignments[12].hsps[0].identities, (60, 277))
11260         self.assertEqual(record.rounds[3].alignments[12].hsps[0].positives, (109, 277))
11261         self.assertEqual(record.rounds[3].alignments[12].hsps[0].gaps, (29, 277))
11262         self.assertEqual(record.rounds[3].alignments[13].hsps[0].identities, (68, 259))
11263         self.assertEqual(record.rounds[3].alignments[13].hsps[0].positives, (125, 259))
11264         self.assertEqual(record.rounds[3].alignments[13].hsps[0].gaps, (21, 259))
11265         self.assertEqual(record.rounds[3].alignments[14].hsps[0].identities, (25, 71))
11266         self.assertEqual(record.rounds[3].alignments[14].hsps[0].positives, (35, 71))
11267         self.assertEqual(record.rounds[3].alignments[15].hsps[0].identities, (22, 72))
11268         self.assertEqual(record.rounds[3].alignments[15].hsps[0].positives, (30, 72))
11269         self.assertEqual(record.rounds[3].alignments[16].hsps[0].identities, (25, 71))
11270         self.assertEqual(record.rounds[3].alignments[16].hsps[0].positives, (34, 71))
11271         self.assertEqual(record.rounds[3].alignments[17].hsps[0].identities, (25, 71))
11272         self.assertEqual(record.rounds[3].alignments[17].hsps[0].positives, (36, 71))
11273         self.assertEqual(record.rounds[3].alignments[18].hsps[0].identities, (22, 80))
11274         self.assertEqual(record.rounds[3].alignments[18].hsps[0].positives, (30, 80))
11275         self.assertEqual(record.rounds[3].alignments[18].hsps[0].gaps, (6, 80))
11276         self.assertEqual(record.rounds[3].alignments[19].hsps[0].identities, (18, 63))
11277         self.assertEqual(record.rounds[3].alignments[19].hsps[0].positives, (28, 63))
11278         self.assertEqual(record.rounds[3].alignments[20].hsps[0].identities, (17, 62))
11279         self.assertEqual(record.rounds[3].alignments[20].hsps[0].positives, (29, 62))
11280         self.assertEqual(record.rounds[3].alignments[21].hsps[0].identities, (20, 49))
11281         self.assertEqual(record.rounds[3].alignments[21].hsps[0].positives, (23, 49))
11282         self.assertEqual(record.rounds[3].alignments[21].hsps[0].gaps, (6, 49))
11283         self.assertEqual(record.rounds[3].alignments[22].hsps[0].identities, (17, 92))
11284         self.assertEqual(record.rounds[3].alignments[22].hsps[0].positives, (25, 92))
11285         self.assertEqual(record.rounds[3].alignments[22].hsps[0].gaps, (13, 92))
11286         self.assertEqual(record.rounds[3].alignments[23].hsps[0].identities, (22, 95))
11287         self.assertEqual(record.rounds[3].alignments[23].hsps[0].positives, (35, 95))
11288         self.assertEqual(record.rounds[4].alignments[0].hsps[0].identities, (765, 889))
11289         self.assertEqual(record.rounds[4].alignments[0].hsps[0].positives, (765, 889))
11290         self.assertEqual(record.rounds[4].alignments[1].hsps[0].identities, (281, 635))
11291         self.assertEqual(record.rounds[4].alignments[1].hsps[0].positives, (374, 635))
11292         self.assertEqual(record.rounds[4].alignments[1].hsps[0].gaps, (34, 635))
11293         self.assertEqual(record.rounds[4].alignments[1].hsps[1].identities, (69, 209))
11294         self.assertEqual(record.rounds[4].alignments[1].hsps[1].positives, (107, 209))
11295         self.assertEqual(record.rounds[4].alignments[1].hsps[1].gaps, (26, 209))
11296         self.assertEqual(record.rounds[4].alignments[2].hsps[0].identities, (69, 265))
11297         self.assertEqual(record.rounds[4].alignments[2].hsps[0].positives, (115, 265))
11298         self.assertEqual(record.rounds[4].alignments[2].hsps[0].gaps, (18, 265))
11299         self.assertEqual(record.rounds[4].alignments[3].hsps[0].identities, (71, 268))
11300         self.assertEqual(record.rounds[4].alignments[3].hsps[0].positives, (119, 268))
11301         self.assertEqual(record.rounds[4].alignments[3].hsps[0].gaps, (23, 268))
11302         self.assertEqual(record.rounds[4].alignments[4].hsps[0].identities, (71, 268))
11303         self.assertEqual(record.rounds[4].alignments[4].hsps[0].positives, (117, 268))
11304         self.assertEqual(record.rounds[4].alignments[4].hsps[0].gaps, (23, 268))
11305         self.assertEqual(record.rounds[4].alignments[5].hsps[0].identities, (69, 265))
11306         self.assertEqual(record.rounds[4].alignments[5].hsps[0].positives, (116, 265))
11307         self.assertEqual(record.rounds[4].alignments[5].hsps[0].gaps, (18, 265))
11308         self.assertEqual(record.rounds[4].alignments[6].hsps[0].identities, (67, 249))
11309         self.assertEqual(record.rounds[4].alignments[6].hsps[0].positives, (116, 249))
11310         self.assertEqual(record.rounds[4].alignments[6].hsps[0].gaps, (12, 249))
11311         self.assertEqual(record.rounds[4].alignments[7].hsps[0].identities, (67, 249))
11312         self.assertEqual(record.rounds[4].alignments[7].hsps[0].positives, (114, 249))
11313         self.assertEqual(record.rounds[4].alignments[7].hsps[0].gaps, (13, 249))
11314         self.assertEqual(record.rounds[4].alignments[8].hsps[0].identities, (58, 271))
11315         self.assertEqual(record.rounds[4].alignments[8].hsps[0].positives, (116, 271))
11316         self.assertEqual(record.rounds[4].alignments[8].hsps[0].gaps, (16, 271))
11317         self.assertEqual(record.rounds[4].alignments[9].hsps[0].identities, (58, 286))
11318         self.assertEqual(record.rounds[4].alignments[9].hsps[0].positives, (109, 286))
11319         self.assertEqual(record.rounds[4].alignments[9].hsps[0].gaps, (28, 286))
11320         self.assertEqual(record.rounds[4].alignments[10].hsps[0].identities, (64, 250))
11321         self.assertEqual(record.rounds[4].alignments[10].hsps[0].positives, (107, 250))
11322         self.assertEqual(record.rounds[4].alignments[10].hsps[0].gaps, (19, 250))
11323         self.assertEqual(record.rounds[4].alignments[11].hsps[0].identities, (58, 256))
11324         self.assertEqual(record.rounds[4].alignments[11].hsps[0].positives, (96, 256))
11325         self.assertEqual(record.rounds[4].alignments[11].hsps[0].gaps, (15, 256))
11326         self.assertEqual(record.rounds[4].alignments[12].hsps[0].identities, (60, 277))
11327         self.assertEqual(record.rounds[4].alignments[12].hsps[0].positives, (109, 277))
11328         self.assertEqual(record.rounds[4].alignments[12].hsps[0].gaps, (29, 277))
11329         self.assertEqual(record.rounds[4].alignments[13].hsps[0].identities, (66, 258))
11330         self.assertEqual(record.rounds[4].alignments[13].hsps[0].positives, (120, 258))
11331         self.assertEqual(record.rounds[4].alignments[13].hsps[0].gaps, (19, 258))
11332         self.assertEqual(record.rounds[4].alignments[14].hsps[0].identities, (22, 73))
11333         self.assertEqual(record.rounds[4].alignments[14].hsps[0].positives, (30, 73))
11334         self.assertEqual(record.rounds[4].alignments[15].hsps[0].identities, (25, 73))
11335         self.assertEqual(record.rounds[4].alignments[15].hsps[0].positives, (35, 73))
11336         self.assertEqual(record.rounds[4].alignments[16].hsps[0].identities, (25, 73))
11337         self.assertEqual(record.rounds[4].alignments[16].hsps[0].positives, (36, 73))
11338         self.assertEqual(record.rounds[4].alignments[17].hsps[0].identities, (25, 71))
11339         self.assertEqual(record.rounds[4].alignments[17].hsps[0].positives, (34, 71))
11340         self.assertEqual(record.rounds[4].alignments[18].hsps[0].identities, (22, 80))
11341         self.assertEqual(record.rounds[4].alignments[18].hsps[0].positives, (30, 80))
11342         self.assertEqual(record.rounds[4].alignments[18].hsps[0].gaps, (6, 80))
11343         self.assertEqual(record.rounds[4].alignments[19].hsps[0].identities, (18, 63))
11344         self.assertEqual(record.rounds[4].alignments[19].hsps[0].positives, (28, 63))
11345         self.assertEqual(record.rounds[4].alignments[20].hsps[0].identities, (17, 62))
11346         self.assertEqual(record.rounds[4].alignments[20].hsps[0].positives, (29, 62))
11347         self.assertEqual(record.rounds[4].alignments[21].hsps[0].identities, (20, 49))
11348         self.assertEqual(record.rounds[4].alignments[21].hsps[0].positives, (23, 49))
11349         self.assertEqual(record.rounds[4].alignments[21].hsps[0].gaps, (6, 49))
11350         self.assertEqual(record.rounds[4].alignments[22].hsps[0].identities, (17, 92))
11351         self.assertEqual(record.rounds[4].alignments[22].hsps[0].positives, (25, 92))
11352         self.assertEqual(record.rounds[4].alignments[22].hsps[0].gaps, (13, 92))
11353         self.assertEqual(record.rounds[4].alignments[23].hsps[0].identities, (22, 95))
11354         self.assertEqual(record.rounds[4].alignments[23].hsps[0].positives, (35, 95))

Here is the caller graph for this function:

Definition at line 11355 of file test_NCBITextParser.py.

11355 
11356     def _check_bt060_hsps_details(self, record):
11357         self.assertEqual(record.rounds[0].alignments[0].hsps[0].query, "MMSARGDFLNYALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQALIYWIKAMNQQTTLDTPQXXXXXXXXXXXXGIXXXXXXXXXXXXTSQSATLNDKDDESLPAETGQNHPFFRRSDSMTFLGCIPPNPFEVPLAEAIPLADQPHLLQPNARKEDLFGRPSQGLYSSSAGSGKCLVEVTMDRNCLEVLPTKMSYAANLKNVMNMQNRQKKAGEDQSMLAEEADSSKPGPSAHDVAAQLKSSLLAEIGLTESEGPPLTSFRPQCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKESKFRREMEKLRNQQSRDLSLEVDRDRDLLIQQTMRQLNNHFGRRCATTPMAVHRVKVTFKDEPGEGSGVARSFYTAIAQAFLSNEKLPNLDCIQNANKGTHTSLMQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSIDTRPFRPASEGNPSDDPDPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGAXXXXXXXXXXXXEKVQENRKRHGSSRSVVXXXXXXXXXXXXNAPLFYQPGKRGFYTPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVPXXXXXXXXXXXXXXXXXXXNFGFV")
11358         self.assertEqual(record.rounds[0].alignments[0].hsps[0].match, "MMSARGDFLNYALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQALIYWIKAMNQQTTLDTPQ            GI            TSQSATLNDKDDESLPAETGQNHPFFRRSDSMTFLGCIPPNPFEVPLAEAIPLADQPHLLQPNARKEDLFGRPSQGLYSSSAGSGKCLVEVTMDRNCLEVLPTKMSYAANLKNVMNMQNRQKKAGEDQSMLAEEADSSKPGPSAHDVAAQLKSSLLAEIGLTESEGPPLTSFRPQCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKESKFRREMEKLRNQQSRDLSLEVDRDRDLLIQQTMRQLNNHFGRRCATTPMAVHRVKVTFKDEPGEGSGVARSFYTAIAQAFLSNEKLPNLDCIQNANKGTHTSLMQ                                      QLSIDTRPFRPASEGNPSDDPDPLPAHRQALGERLYPRVQAMQPAFASKITGM                   RARVEEAMELIVAHGRENGA            EKVQENRKRHGSSRSVV            NAPLFYQPGKRGFYTPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVP                   NFGFV")
11359         self.assertEqual(record.rounds[0].alignments[0].hsps[0].sbjct, "MMSARGDFLNYALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQALIYWIKAMNQQTTLDTPQLERKRTRELLELGIDNEDSEHENDDDTSQSATLNDKDDESLPAETGQNHPFFRRSDSMTFLGCIPPNPFEVPLAEAIPLADQPHLLQPNARKEDLFGRPSQGLYSSSAGSGKCLVEVTMDRNCLEVLPTKMSYAANLKNVMNMQNRQKKAGEDQSMLAEEADSSKPGPSAHDVAAQLKSSLLAEIGLTESEGPPLTSFRPQCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKESKFRREMEKLRNQQSRDLSLEVDRDRDLLIQQTMRQLNNHFGRRCATTPMAVHRVKVTFKDEPGEGSGVARSFYTAIAQAFLSNEKLPNLDCIQNANKGTHTSLMQRLRNRGERDREREREREMRRSSGLRAGSRRDRDRDFRRQLSIDTRPFRPASEGNPSDDPDPLPAHRQALGERLYPRVQAMQPAFASKITGMLLELSPAQLLLLLASEDSLRARVEEAMELIVAHGRENGADSILDLGLLDSSEKVQENRKRHGSSRSVVDMDLDDTDDGDDNAPLFYQPGKRGFYTPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVPLYSSKQILKQKLLLAIKTKNFGFV")
11360         self.assertEqual(record.rounds[0].alignments[0].hsps[0].query_start, 1)
11361         self.assertEqual(record.rounds[0].alignments[0].hsps[0].query_end, 889)
11362         self.assertEqual(record.rounds[0].alignments[0].hsps[0].sbjct_start, 1)
11363         self.assertEqual(record.rounds[0].alignments[0].hsps[0].sbjct_end, 889)
11364         self.assertEqual(record.rounds[0].alignments[1].hsps[0].query, "QCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKESKFRREMEKLRNQQSRDLSL-EVDRDRDLLIQQTMRQLNNHFGR--RCATTPMAVHRVKVTFKDEPGEGSGVARSFYTAIAQAFLSNEKLPNLDCIQNANKGTHTSLMQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSIDTRPFRPASEGN---PSDDPDPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGAXXXXXXXXXXXXEKVQENRKRHGSSRSVVXXXXXXXXXXXXNAPLFYQPGKRGFYTPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVA-EQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVPXXXXXXXXXXXXXXXXXXXNFGFV")
11365         self.assertEqual(record.rounds[0].alignments[1].hsps[0].match, "Q +F G+   + +L  +  L+L+LFGR FM+DVG E GS+L EL GF VKE +FRR MEKLRN Q RDL L +++R+R+ LI QT ++LN  FG   R    P+  +RVKVTFKDEPGEGSGVARSFYT+IA+A L++ K+PNL+ +Q      H+  +                                        L++D RP+ P +  +   P    D L  H Q +GERLYP++ ++    A KITGM                   R +V EA+E+I    +   +               Q ++ +   S  VV            N PLFY PGKRGFY PR G  +  R+N FRNIGR++GLCLLQNEL P+ L RHV+K +L RK+ +HD AFFDP +YES RQ+I  +Q+ + +   + M+L F +DL KEEG G  ELIP G ++ V+ + +Y       ++   + + E+ L A++ G+ DVLP NS+ +LTAED RLL+NG G++NV  LIS+T+FNDES E  +KL +FK+WFWSIVE+M++ ERQ LVYFWT SP+LPASEEGFQP+PS+TIRP DD HLPTANTCISRLY+P                   NFGFV")
11366         self.assertEqual(record.rounds[0].alignments[1].hsps[0].sbjct, "QSNFSGIAPCNFLLSAK--LTLDLFGRPFMDDVGMEHGSVLPELRGFPVKEMRFRRHMEKLRNGQQRDLVLCKLERNRESLIVQTFKELNTQFGNQSRRIQPPITFNRVKVTFKDEPGEGSGVARSFYTSIAEALLASAKIPNLESVQVGTN--HSKYVVPFSSILRTTVSGSSRDQSTLQRRGSNSKILWRSARERKALNLDARPYTPPNSSDNATPESLNDHLSVHLQQIGERLYPKIHSINQTHAPKITGMLLEIPTPQLLSVISSDETLRQKVNEAIEIITFKQKSETSA--------------QSSQPKKSPSVVVVDPVDDD------NEPLFYSPGKRGFYIPRQGFASFERINAFRNIGRLIGLCLLQNELLPLFLQRHVLKYILRRKIKFHDLAFFDPALYESFRQIIQNAQTKEGEETINRMELCFVIDLMKEEGCGNRELIPGGRDV-VSHRVIYSSTSDAIQNIDXIKSQEKALEALKDGVFDVLPDNSMINLTAEDLRLLLNGVGDINVSTLISYTTFNDESSEGPDKLXKFKKWFWSIVEKMNIMERQHLVYFWTGSPALPASEEGFQPLPSVTIRPADDSHLPTANTCISRLYIPLYSSKSILRSKMLMAIKSKNFGFV")
11367         self.assertEqual(record.rounds[0].alignments[1].hsps[0].query_start, 263)
11368         self.assertEqual(record.rounds[0].alignments[1].hsps[0].query_end, 889)
11369         self.assertEqual(record.rounds[0].alignments[1].hsps[0].sbjct_start, 2287)
11370         self.assertEqual(record.rounds[0].alignments[1].hsps[0].sbjct_end, 2895)
11371         self.assertEqual(record.rounds[0].alignments[1].hsps[1].query, "SARGDFLNYALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQALIYWIKAMNQQTTLDTPQXXXXXXXXXXXXGIXXXXXXXXXXXXTSQSATLNDKDDE------SLPA--ETGQNHPFFRRSDSMTFLGCIPPNPFEVPLAEAIPLADQPHLLQPNARKEDLFGRPSQGLYSSSAGSGKCLVEVTMD---RNCLEVLPTKMSYAANLK")
11372         self.assertEqual(record.rounds[0].alignments[1].hsps[1].match, "++R DF  Y LSLMRSH  EH D LPVLD+ +L+H+AYV  A +Y+++  N     D                I              + A L + + +      S+P+  +  + H FF RS+S   LGC  P  FE+PL  A+PLAD+PHLLQPN+++++LF      + +++  SG      T D    +  +  PT++ ++ +LK")
11373         self.assertEqual(record.rounds[0].alignments[1].hsps[1].sbjct, "NSRRDFFTYCLSLMRSHTSEHRDALPVLDITALRHIAYVLDAFVYYMR--NDSGFYDKQDSISGR--------INNLSPMTESYDTDDELANLEEFNADVQMSASSMPSGSQGTRRHAFFARSESTLTLGCSAPEGFELPLDMAMPLADKPHLLQPNSKRQELFANLPLLVTTNANNSG-----ATNDGDGASIFDYTPTRLGFSNSLK")
11374         self.assertEqual(record.rounds[0].alignments[1].hsps[1].query_start, 3)
11375         self.assertEqual(record.rounds[0].alignments[1].hsps[1].query_end, 200)
11376         self.assertEqual(record.rounds[0].alignments[1].hsps[1].sbjct_start, 1913)
11377         self.assertEqual(record.rounds[0].alignments[1].hsps[1].sbjct_end, 2106)
11378         self.assertEqual(record.rounds[0].alignments[2].hsps[0].query, "PRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQ-------PMPSITIRPPDDQHLPTANTCISRLYVP")
11379         self.assertEqual(record.rounds[0].alignments[2].hsps[0].match, "P  G N E  LN F+ IGR++GL +               K++L +KV   D    D   Y SL  ++    +   D  FS  D  F   +        ++L PNG NI VT +N  EYV      R+    E+  +A  +G  +++P+  +      +  LL+ G  E++++     T +   S  +     Q  +WFW +++  S  ++  L+ F T +  +P +  GF+       P      +  +   LP A+TC +RL +P")
11380         self.assertEqual(record.rounds[0].alignments[2].hsps[0].sbjct, "PHSGINPE-HLNYFKFIGRVIGLAIFHRRFVDAFFVVSFYKMILQKKVTLQDMESMDAEYYRSLVWILDNDITGVLDLTFSVEDNCFGEVVT-------IDLKPNGRNIEVTEENKREYVDLVTVWRIQKRIEEQFNAFHEGFSELIPQELINVFDERELELLIGGISEIDMEDWKKHTDYRSYSEND-----QIIKWFWELMDEWSNEKKSRLLQFTTGTSRIPVN--GFKDLQGSDGPRKFTIEKAGEPNKLPKAHTCFNRLDLP")
11381         self.assertEqual(record.rounds[0].alignments[2].hsps[0].query_start, 606)
11382         self.assertEqual(record.rounds[0].alignments[2].hsps[0].query_end, 865)
11383         self.assertEqual(record.rounds[0].alignments[2].hsps[0].sbjct_start, 491)
11384         self.assertEqual(record.rounds[0].alignments[2].hsps[0].sbjct_end, 742)
11385         self.assertEqual(record.rounds[0].alignments[3].hsps[0].query, "PRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPS------ITIRPPDD-QHLPTANTCISRLYVP")
11386         self.assertEqual(record.rounds[0].alignments[3].hsps[0].match, "P  G N E  LN F+ IGR++GL +             + K++L +KV   D    D  +Y SL  ++  S     D  FSA D  F   +        V+L P+G NI VT  N  EYV  Y + R++   ++   A   G  +++P++ +      +  LL+ G  E++++     T +     + +++++Q   WFW  V      +R  L+ F T +  +P +  GF+ +         TI    + Q LP ++TC +R+ +P")
11387         self.assertEqual(record.rounds[0].alignments[3].hsps[0].sbjct, "PNSGINPE-HLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKMMLRKKVVLQDMEGVDAEVYNSLNWMLENSIDGVLDLTFSADDERFGEVVT-------VDLKPDGRNIEVTDGNKKEYVELYTQWRIVDRVQEQFKAFMDGFNELIPEDLVTVFDERELELLIGGIAEIDIEDWKKHTDY--RGYQESDEVIQ---WFWKCVSEWDNEQRARLLQFTTGTSRIPVN--GFKDLQGSDGPRRFTIEKAGEVQQLPKSHTCFNRVDLP")
11388         self.assertEqual(record.rounds[0].alignments[3].hsps[0].query_start, 606)
11389         self.assertEqual(record.rounds[0].alignments[3].hsps[0].query_end, 865)
11390         self.assertEqual(record.rounds[0].alignments[3].hsps[0].sbjct_start, 533)
11391         self.assertEqual(record.rounds[0].alignments[3].hsps[0].sbjct_end, 784)
11392         self.assertEqual(record.rounds[0].alignments[4].hsps[0].query, "PRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQV---ELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLP----ASEEGFQPMPSITIRP-PDDQHLPTANTCISRLYVP")
11393         self.assertEqual(record.rounds[0].alignments[4].hsps[0].match, "P  G   E  L+ F+ IGR+ G+ +   +L      R   K++L + +  HD    D   Y SLR ++     +D     + +DL F +D   EE  GQ    EL   G  I VT +N  EY+    + R +   ++ + A ++G  +++P++ ++     +  LL+ G G+V+V      T + +    N + +    +WFW  V  M   +R  L+ F T +  +P    A   G     S T+      + LP A+TC +RL +P")
11394         self.assertEqual(record.rounds[0].alignments[4].hsps[0].sbjct, "PNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHDMESVDSEYYNSLRWIL----ENDP----TELDLRFIID---EELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSANHQVI----QWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLP")
11395         self.assertEqual(record.rounds[0].alignments[4].hsps[0].query_start, 606)
11396         self.assertEqual(record.rounds[0].alignments[4].hsps[0].query_end, 865)
11397         self.assertEqual(record.rounds[0].alignments[4].hsps[0].sbjct_start, 649)
11398         self.assertEqual(record.rounds[0].alignments[4].hsps[0].sbjct_end, 901)
11399         self.assertEqual(record.rounds[0].alignments[5].hsps[0].query, "PRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQV---ELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLP----ASEEGFQPMPSITIR---PPDDQHLPTANTCISRLYVP")
11400         self.assertEqual(record.rounds[0].alignments[5].hsps[0].match, "P  G   E  L+ F+ IGR+ G+ +   +L      R   K++L + +  HD    D   Y SLR ++    +         +DL F +D   EE  GQ    EL   G  I VT +N  EY+    + R +   ++ + A ++G  +++P++ ++     +  LL+ G G+V+V      T + +    N + +     WFW  V  M   +R  L+ F T +  +P    A   G     S T+     PD   LP A+TC +RL +P")
11401         self.assertEqual(record.rounds[0].alignments[5].hsps[0].sbjct, "PNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLQKLITLHDMESVDSEYYSSLRWILENDPTE--------LDLRFIID---EELFGQTHQHELKTGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSMNHQVI----HWFWKAVWMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPD--KLPRAHTCFNRLDLP")
11402         self.assertEqual(record.rounds[0].alignments[5].hsps[0].query_start, 606)
11403         self.assertEqual(record.rounds[0].alignments[5].hsps[0].query_end, 865)
11404         self.assertEqual(record.rounds[0].alignments[5].hsps[0].sbjct_start, 679)
11405         self.assertEqual(record.rounds[0].alignments[5].hsps[0].sbjct_end, 931)
11406         self.assertEqual(record.rounds[0].alignments[6].hsps[0].query, "GRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQV-ELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLP----ASEEGFQPMPSITIRPPD--DQHLPTANTCISRLYVP")
11407         self.assertEqual(record.rounds[0].alignments[6].hsps[0].match, "GR +   ++   L      R   K +LG+ V + D    D   Y+ L  L+      + D      DL F+ ++ +E G  +V +L PNG NI VT +N  EYV    + RM     + L A  +G  +++PK  +   T ++  LL  G   +++  L S T ++     + +      +WFW  +      +R   + F T +  +P    A+ EG   +    I   D     LP+A+TC ++L +P")
11408         self.assertEqual(record.rounds[0].alignments[6].hsps[0].sbjct, "GRYVAKAVMTTALLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLL------ENDVSTLGYDLTFSTEV-QEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLYTGLPTIDIDDLKSNTEYHKYQSNSIQ-----IQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLP")
11409         self.assertEqual(record.rounds[0].alignments[6].hsps[0].query_start, 623)
11410         self.assertEqual(record.rounds[0].alignments[6].hsps[0].query_end, 865)
11411         self.assertEqual(record.rounds[0].alignments[6].hsps[0].sbjct_start, 45)
11412         self.assertEqual(record.rounds[0].alignments[6].hsps[0].sbjct_end, 282)
11413         self.assertEqual(record.rounds[0].alignments[7].hsps[0].query, "FRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQV-ELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDL-TAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVP")
11414         self.assertEqual(record.rounds[0].alignments[7].hsps[0].match, "F  IG +LGL +  N +  +     V + L+G+K  + D     PV+Y+SL+ L+    + + D     M + F +      G   + +L  NG  IP+T +N  E+V  Y+++ +    E+   A R+G   V  ++ L+ L   E+  LL+ G   ++ Q L   T +  + G   + +L   R FW IV   +  +++  + F T +   P    G   M  I    PD + LPT++TC + L +P")
11415         self.assertEqual(record.rounds[0].alignments[7].hsps[0].sbjct, "FTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGNVEDD-----MMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEY--DGGYTRDSVL--IREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKM-IIAKNGPDTERLPTSHTCFNVLLLP")
11416         self.assertEqual(record.rounds[0].alignments[7].hsps[0].query_start, 619)
11417         self.assertEqual(record.rounds[0].alignments[7].hsps[0].query_end, 865)
11418         self.assertEqual(record.rounds[0].alignments[7].hsps[0].sbjct_start, 612)
11419         self.assertEqual(record.rounds[0].alignments[7].hsps[0].sbjct_end, 850)
11420         self.assertEqual(record.rounds[0].alignments[8].hsps[0].query, "IGRILGLCLLQNELCPITLNRHVIKVLL----GRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGE-VNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPM-PSITIRPPDDQ--HLPTANTCISRLYVP")
11421         self.assertEqual(record.rounds[0].alignments[8].hsps[0].match, "+G+++G CL ++ L  ++     +K LL    G   ++ D   +D V+Y +L +L+  + ++D      ++DL F +D   E     V+LIPNG    VT  NV  YV K  ++++     +P+ A   GL  ++  + +E   + + ++L++G  + +++  L S T +     E+     Q    FW ++      E+ + + F TS P  P   +GF+ + P   IR    +   LPTA+TC++ L +P")
11422         self.assertEqual(record.rounds[0].alignments[8].hsps[0].sbjct, "LGKVVGKCLYEHVLIDVSFADFFLKKLLNYSNGFLSSFSDLGSYDSVLYNNLIKLL--NMTTDE---IKSLDLTFEIDE-PESSAKVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWMEMFNSIELQMLISGERDNIDLDDLKSNTEYGGYKEED-----QTIVDFWEVLNEFKFEEKLNFLKFVTSVPQAPL--QGFKALDPKFGIRNAGTEKYRLPTASTCVNLLKLP")
11423         self.assertEqual(record.rounds[0].alignments[8].hsps[0].query_start, 622)
11424         self.assertEqual(record.rounds[0].alignments[8].hsps[0].query_end, 865)
11425         self.assertEqual(record.rounds[0].alignments[8].hsps[0].sbjct_start, 647)
11426         self.assertEqual(record.rounds[0].alignments[8].hsps[0].sbjct_end, 885)
11427         self.assertEqual(record.rounds[0].alignments[9].hsps[0].query, "ILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQV-ELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDL-TAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVP")
11428         self.assertEqual(record.rounds[0].alignments[9].hsps[0].match, "ILGL +  N +  +     V + L+G+K  + D     PV+Y+SL+ L+    S + D     M + F +      G   + +L  NG  IP+T +N  E+V  Y+++ +    E+   A R+G   V  ++ L+ L   E+  LL+ G   ++ Q L   T +  + G   E ++   R FW IV   +  +++  + F T +   P    G   M  I    PD + LPT++TC + L +P")
11429         self.assertEqual(record.rounds[0].alignments[9].hsps[0].sbjct, "ILGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGSVEDD-----MMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVISYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEY--DGGYTRESVV--IREFWEIVHSFTDEQKRLFLLFTTGTDRAPVGGLGKLKM-IIAKNGPDTERLPTSHTCFNVLLLP")
11430         self.assertEqual(record.rounds[0].alignments[9].hsps[0].query_start, 625)
11431         self.assertEqual(record.rounds[0].alignments[9].hsps[0].query_end, 865)
11432         self.assertEqual(record.rounds[0].alignments[9].hsps[0].sbjct_start, 628)
11433         self.assertEqual(record.rounds[0].alignments[9].hsps[0].sbjct_end, 860)
11434         self.assertEqual(record.rounds[0].alignments[10].hsps[0].query, "GKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAV------DLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPK-NSLEDLTAEDFRLLVNGCGE---VNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRL")
11435         self.assertEqual(record.rounds[0].alignments[10].hsps[0].match, "GKN++  L  +   G ++GL +  + +  +   + + K L    +++ D++   P    +L +++  ++ +  D      +  +        D    +    VEL  NG N+P+T  N +E+V K+ E  +    E   +    G   V  + NS++   +E+   LV G  E    + + L S T +     +++  +     WFW I+E      ++ L+ F T+S  +PA+     P     +   D   LP A+TC + +")
11436         self.assertEqual(record.rounds[0].alignments[10].hsps[0].sbjct, "GKNSQLEL--YYLFGVVMGLAIFNSTILDLQFPKALYKKLCSEPLSFEDYSELFPETSRNLIKMLNYTEDNFEDVFSLTFETTYRNNNWILNDSKSSKEYVTVELCENGRNVPITQSNKHEFVMKWVEFYLEKSIEPQYNKFVSGFKRVFAECNSIKLFNSEELERLVCGDEEQTKFDFKSLRSVTKYVGGFSDDSRAVC----WFWEIIESWDYPLQKKLLQFVTASDRIPATGISTIPFKISLLGSHDSDDLPLAHTCFNEI")
11437         self.assertEqual(record.rounds[0].alignments[10].hsps[0].query_start, 609)
11438         self.assertEqual(record.rounds[0].alignments[10].hsps[0].query_end, 862)
11439         self.assertEqual(record.rounds[0].alignments[10].hsps[0].sbjct_start, 607)
11440         self.assertEqual(record.rounds[0].alignments[10].hsps[0].sbjct_end, 864)
11441         self.assertEqual(record.rounds[0].alignments[11].hsps[0].query, "DPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLP-ASEEGFQPMPSITIRPPD-----DQHLPTANTCISRLYVP")
11442         self.assertEqual(record.rounds[0].alignments[11].hsps[0].match, "DP++ +SL+ ++    + D +    ++ L F V      G   +ELIP G N  +   NV EY+    +  +    E+ L A  +G   V     +  L  ++  + + G  E +  M   +T+ N E G   +  +     F SI+      ER+  + F T SP LP    +   P  ++ ++  +     D++LP+  TC + L +P")
11443         self.assertEqual(record.rounds[0].alignments[11].hsps[0].sbjct, "DPLLAKSLKYIVA---NKDDNMTLESLSLTFTVP-----GNDDIELIPGGCNKSLNSSNVEEYIHGVIDQILGKGIEKQLKAFIEGFSKVFSYERMLILFPDEL-VDIFGRVEEDWSMATLYTNLNAEHGYTMDSSIIHD--FISIISAFGKHERRLFLQFLTGSPKLPIGGFKSLNPKFTVVLKHAEDGLTADEYLPSVMTCANYLKLP")
11444         self.assertEqual(record.rounds[0].alignments[11].hsps[0].query_start, 662)
11445         self.assertEqual(record.rounds[0].alignments[11].hsps[0].query_end, 865)
11446         self.assertEqual(record.rounds[0].alignments[11].hsps[0].sbjct_start, 1259)
11447         self.assertEqual(record.rounds[0].alignments[11].hsps[0].sbjct_end, 1457)
11448         self.assertEqual(record.rounds[0].alignments[12].hsps[0].query, "NCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGG--GQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITI----RPPDDQHLPTANTCISRLYVP")
11449         self.assertEqual(record.rounds[0].alignments[12].hsps[0].match, "N F  IG   GL +  + +  +     + K LL  K    D     P    SL++L L     D +  F    L F +  C+E  G   Q +LIP G N+ V   N  E+V  Y  +   +   +   A   G L V     LE     + R ++ G    N + L     +  +       +    + FW       + +++  + F T S  +P        M S+ I        +++LP A+TC + L +P")
11450         self.assertEqual(record.rounds[0].alignments[12].hsps[0].sbjct, "NWFHLIGITCGLAIYNSTVVDLHFPLALYKKLLNVKPGLEDLKELSPTEGRSLQEL-LDYPGEDVEETFC---LNFTI--CRESYGVIEQKKLIPGGDNVTVCKDNRQEFVDAYVNYVFQISVHEWYTAFSSGFLKVCGGKVLELFQPSELRAMMVGNSNYNWEELEETAIYKGDYSATHPTV----KLFWETFHEFPLEKKKKFLLFLTGSDRIP-----IYGMASLQIVIQSTASGEEYLPVAHTCYNLLDLP")
11451         self.assertEqual(record.rounds[0].alignments[12].hsps[0].query_start, 617)
11452         self.assertEqual(record.rounds[0].alignments[12].hsps[0].query_end, 865)
11453         self.assertEqual(record.rounds[0].alignments[12].hsps[0].sbjct_start, 786)
11454         self.assertEqual(record.rounds[0].alignments[12].hsps[0].sbjct_end, 1025)
11455         self.assertEqual(record.rounds[0].alignments[13].hsps[0].query, "TPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNW--HDFAFFDPVMYES---LRQLILASQSSDADAVFSAMDLAFAVDL-----CKEEGGG---------QVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPM-PSITI--------RPPDDQHLPTANTCISRLYVP")
11456         self.assertEqual(record.rounds[0].alignments[13].hsps[0].match, "T +P    + ++  FR +G+++   ++   L  + L     K +L ++ +   HD    DPV+  S   L  ++   +  + D   +   L +A++      C  E  G          +EL   G +IPVT  N+ EY+R      +     +   + R G   V P + L+    E+   L+ G                 + G   +   +  ++ + I+      +++  + F T SP LP    GF+ + P +TI          PDD  LP+  TC++ L +P")
11457         self.assertEqual(record.rounds[0].alignments[13].hsps[0].sbjct, "TAKPAHIAKVKMK-FRFLGKLMAKAIMDFRLVDLPLGLPFYKWMLRQETSLTSHDLFDIDPVVARSVYHLEDIVRQKKRLEQDKSQTKESLQYALETLTMNGCSVEDLGLDFTLPGFPNIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVSRQFDSFRDGFESVFPLSHLQYFYPEELDQLLCGSKADTWDAKTLMECCRPDHGYTHDS--RAVKFLFEILSSFDNEQQRLFLQFVTGSPRLPVG--GFRSLNPPLTIVRKTFESTENPDD-FLPSVMTCVNYLKLP")
11458         self.assertEqual(record.rounds[0].alignments[13].hsps[0].query_start, 605)
11459         self.assertEqual(record.rounds[0].alignments[13].hsps[0].query_end, 865)
11460         self.assertEqual(record.rounds[0].alignments[13].hsps[0].sbjct_start, 1684)
11461         self.assertEqual(record.rounds[0].alignments[13].hsps[0].sbjct_end, 1966)
11462         self.assertEqual(record.rounds[0].alignments[14].hsps[0].query, "PLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGA")
11463         self.assertEqual(record.rounds[0].alignments[14].hsps[0].match, "P    +Q LGERL+P +QAM P+ A KITGM                   R++V+EA+ ++ AH  +  A")
11464         self.assertEqual(record.rounds[0].alignments[14].hsps[0].sbjct, "PPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAA")
11465         self.assertEqual(record.rounds[0].alignments[14].hsps[0].query_start, 480)
11466         self.assertEqual(record.rounds[0].alignments[14].hsps[0].query_end, 549)
11467         self.assertEqual(record.rounds[0].alignments[14].hsps[0].sbjct_start, 554)
11468         self.assertEqual(record.rounds[0].alignments[14].hsps[0].sbjct_end, 623)
11469         self.assertEqual(record.rounds[0].alignments[15].hsps[0].query, "PLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGA")
11470         self.assertEqual(record.rounds[0].alignments[15].hsps[0].match, "P    +Q LGERL+P +QAM P  A KITGM                   R++V+EA+ ++ AH  +  A")
11471         self.assertEqual(record.rounds[0].alignments[15].hsps[0].sbjct, "PPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAA")
11472         self.assertEqual(record.rounds[0].alignments[15].hsps[0].query_start, 480)
11473         self.assertEqual(record.rounds[0].alignments[15].hsps[0].query_end, 549)
11474         self.assertEqual(record.rounds[0].alignments[15].hsps[0].sbjct_start, 554)
11475         self.assertEqual(record.rounds[0].alignments[15].hsps[0].sbjct_end, 623)
11476         self.assertEqual(record.rounds[0].alignments[16].hsps[0].query, "PLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGA")
11477         self.assertEqual(record.rounds[0].alignments[16].hsps[0].match, "P    +Q LGERL+P +QAM P  A KITGM                   R +V+EA+ ++ AH  +  A")
11478         self.assertEqual(record.rounds[0].alignments[16].hsps[0].sbjct, "PPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRLKVDEAVAVLQAHQAKEAA")
11479         self.assertEqual(record.rounds[0].alignments[16].hsps[0].query_start, 480)
11480         self.assertEqual(record.rounds[0].alignments[16].hsps[0].query_end, 549)
11481         self.assertEqual(record.rounds[0].alignments[16].hsps[0].sbjct_start, 552)
11482         self.assertEqual(record.rounds[0].alignments[16].hsps[0].sbjct_end, 621)
11483         self.assertEqual(record.rounds[0].alignments[17].hsps[0].query, "RQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAH")
11484         self.assertEqual(record.rounds[0].alignments[17].hsps[0].match, "+Q LGERLYP ++ M    A KITGM                   +A+VEEA+ ++  H")
11485         self.assertEqual(record.rounds[0].alignments[17].hsps[0].sbjct, "KQILGERLYPMIEHMHANLAGKITGMLLEIENSELLHMIEDQEALKAKVEEAVAVLQVH")
11486         self.assertEqual(record.rounds[0].alignments[17].hsps[0].query_start, 485)
11487         self.assertEqual(record.rounds[0].alignments[17].hsps[0].query_end, 543)
11488         self.assertEqual(record.rounds[0].alignments[17].hsps[0].sbjct_start, 567)
11489         self.assertEqual(record.rounds[0].alignments[17].hsps[0].sbjct_end, 625)
11490         self.assertEqual(record.rounds[0].alignments[18].hsps[0].query, "HRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELI")
11491         self.assertEqual(record.rounds[0].alignments[18].hsps[0].match, "H + LG+ LYP V+  +PA  +K+TGM                   +A+V EA++++")
11492         self.assertEqual(record.rounds[0].alignments[18].hsps[0].sbjct, "HPRMLGDHLYPLVEQQEPANPAKVTGMLLEMDQAEILHLLESPEALKAKVSEALDVL")
11493         self.assertEqual(record.rounds[0].alignments[18].hsps[0].query_start, 484)
11494         self.assertEqual(record.rounds[0].alignments[18].hsps[0].query_end, 540)
11495         self.assertEqual(record.rounds[0].alignments[18].hsps[0].sbjct_start, 590)
11496         self.assertEqual(record.rounds[0].alignments[18].hsps[0].sbjct_end, 646)
11497         self.assertEqual(record.rounds[0].alignments[19].hsps[0].query, "RQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELI")
11498         self.assertEqual(record.rounds[0].alignments[19].hsps[0].match, "R  LGE LYP V+ ++   A+K+TGM                   +A+V EAM+++")
11499         self.assertEqual(record.rounds[0].alignments[19].hsps[0].sbjct, "RTMLGEVLYPLVEQVEAESAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVL")
11500         self.assertEqual(record.rounds[0].alignments[19].hsps[0].query_start, 485)
11501         self.assertEqual(record.rounds[0].alignments[19].hsps[0].query_end, 540)
11502         self.assertEqual(record.rounds[0].alignments[19].hsps[0].sbjct_start, 556)
11503         self.assertEqual(record.rounds[0].alignments[19].hsps[0].sbjct_end, 611)
11504         self.assertEqual(record.rounds[0].alignments[20].hsps[0].query, "LADQPHLLQPNARKEDLFGRPSQGLYSSSAGSGKCLVEVTMDRNCLEVLPTKMSYAANLKNVMNMQNRQKKAGEDQSMLAEEADSSK")
11505         self.assertEqual(record.rounds[0].alignments[20].hsps[0].match, "L  Q  +    AR   +  R  + L   +    K  +  T+D    E     + YA   K V+  + ++KKA ED+S L +E + S+")
11506         self.assertEqual(record.rounds[0].alignments[20].hsps[0].sbjct, "LRSQDSMSSDTARTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAY-FKKVLEKEKKRKKASEDESDLEDEEEKSQ")
11507         self.assertEqual(record.rounds[0].alignments[20].hsps[0].query_start, 141)
11508         self.assertEqual(record.rounds[0].alignments[20].hsps[0].query_end, 227)
11509         self.assertEqual(record.rounds[0].alignments[20].hsps[0].sbjct_start, 597)
11510         self.assertEqual(record.rounds[0].alignments[20].hsps[0].sbjct_end, 682)
11511         self.assertEqual(record.rounds[0].alignments[21].hsps[0].query, "PLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELI")
11512         self.assertEqual(record.rounds[0].alignments[21].hsps[0].match, "P  + +Q LGE LYP+V   +   + KITGM                     RV EA+ ++")
11513         self.assertEqual(record.rounds[0].alignments[21].hsps[0].sbjct, "PEESRKQVLGELLYPKVFVREEKLSGKITGMLLEMPNSELLELLEDDSALNERVNEAIGVL")
11514         self.assertEqual(record.rounds[0].alignments[21].hsps[0].query_start, 480)
11515         self.assertEqual(record.rounds[0].alignments[21].hsps[0].query_end, 540)
11516         self.assertEqual(record.rounds[0].alignments[21].hsps[0].sbjct_start, 581)
11517         self.assertEqual(record.rounds[0].alignments[21].hsps[0].sbjct_end, 641)
11518         self.assertEqual(record.rounds[0].alignments[22].hsps[0].query, "RWRLSLELFGRVFMEDVGAEP----GSILTELGGFEVKESKFRREMEKLRNQQSRDLSLEVDRDRDLLIQQTMRQLNNHFGRRCATT------PMAVHR")
11519         self.assertEqual(record.rounds[0].alignments[22].hsps[0].match, "RW       G + ++D   E     GS L   G  EVK    R E+ ++RN   RDL+  V R         MR +  H  +  +        P+AVHR")
11520         self.assertEqual(record.rounds[0].alignments[22].hsps[0].sbjct, "RWIFGAPPAGEITVDDGAVEAMMARGSSLLPKGIREVKGDFSRGEVIRIRNLTGRDLAHGVSRYN----SDAMRMIAGHHSQEISEILGYEYGPVAVHR")
11521         self.assertEqual(record.rounds[0].alignments[22].hsps[0].query_start, 279)
11522         self.assertEqual(record.rounds[0].alignments[22].hsps[0].query_end, 367)
11523         self.assertEqual(record.rounds[0].alignments[22].hsps[0].sbjct_start, 267)
11524         self.assertEqual(record.rounds[0].alignments[22].hsps[0].sbjct_end, 361)
11525         self.assertEqual(record.rounds[0].alignments[23].hsps[0].query, "FEVKESKFRREMEKLRNQQSRDLSLEVDRDRDLLIQQTMRQLNNHFGRRCATTPMAVHRVKVTFKDEPGEGSGVARSFYTA--IAQAFLSNEKLPNLDCI")
11526         self.assertEqual(record.rounds[0].alignments[23].hsps[0].match, "+E++++K++   +KLR +++R+L  E+ R R+   +Q  +Q         A+    +         +P  GSG  R    A  IAQ     +K  NL  I")
11527         self.assertEqual(record.rounds[0].alignments[23].hsps[0].sbjct, "YEIQQTKYQEAQQKLREKKARELE-EIQRLREKNERQNRQQETGQNNADTASGGSNIAPPVPVPNKKPPSGSGGGRDAKQAALIAQKKREEKKRKNLQII")
11528         self.assertEqual(record.rounds[0].alignments[23].hsps[0].query_start, 309)
11529         self.assertEqual(record.rounds[0].alignments[23].hsps[0].query_end, 406)
11530         self.assertEqual(record.rounds[0].alignments[23].hsps[0].sbjct_start, 839)
11531         self.assertEqual(record.rounds[0].alignments[23].hsps[0].sbjct_end, 937)
11532         self.assertEqual(record.rounds[0].alignments[24].hsps[0].query, "LVEVTMDRNCLEVLPTKMSYAANLK-NVMNMQNRQKKAGEDQSMLAEEA---------DSSKPGPSAHDVAAQLKSSLLAEIGLTESEGP")
11533         self.assertEqual(record.rounds[0].alignments[24].hsps[0].match, "L E+  +   L+V+ T+ S    LK  + N+Q  QK+  ++++   E+          + S  GP  H+V+     SL +E+  +++ GP")
11534         self.assertEqual(record.rounds[0].alignments[24].hsps[0].sbjct, "LRELEEENTSLKVIYTRSSEIEELKATIENLQENQKRLQKEKAEEIEQLHEVIEKLQHELSLMGPVVHEVSDSQAGSLQSELLCSQAGGP")
11535         self.assertEqual(record.rounds[0].alignments[24].hsps[0].query_start, 176)
11536         self.assertEqual(record.rounds[0].alignments[24].hsps[0].query_end, 255)
11537         self.assertEqual(record.rounds[0].alignments[24].hsps[0].sbjct_start, 1683)
11538         self.assertEqual(record.rounds[0].alignments[24].hsps[0].sbjct_end, 1772)
11539         self.assertEqual(record.rounds[0].alignments[25].hsps[0].query, "AFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVA---EQPLHAMRKG-LLDVLPKNSLEDL")
11540         self.assertEqual(record.rounds[0].alignments[25].hsps[0].match, "AF VDLC+ +GGG+       + +P++ Q++ +Y+    E    VV    E+ L A+R    +D++   +L  L")
11541         self.assertEqual(record.rounds[0].alignments[25].hsps[0].sbjct, "AFLVDLCERQGGGR------QLRLPMSRQDIADYLGLTIETVSRVVTKLKERSLIALRDARTIDIMKPEALRSL")
11542         self.assertEqual(record.rounds[0].alignments[25].hsps[0].query_start, 691)
11543         self.assertEqual(record.rounds[0].alignments[25].hsps[0].query_end, 760)
11544         self.assertEqual(record.rounds[0].alignments[25].hsps[0].sbjct_start, 142)
11545         self.assertEqual(record.rounds[0].alignments[25].hsps[0].sbjct_end, 209)
11546         self.assertEqual(record.rounds[0].alignments[26].hsps[0].query, "KNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAF--FDPVMYESLRQLILASQSSDADAVF")
11547         self.assertEqual(record.rounds[0].alignments[26].hsps[0].match, "K  EA L+  +NI R +      NE    T N  V+K L GR VNW  +    F  ++Y     +   + SS+ +  F")
11548         self.assertEqual(record.rounds[0].alignments[26].hsps[0].sbjct, "KELEAALDISKNIARSI------NENQRRTENHQVVKKLYGRVVNWKGYRISKFGELLYFDKVFISTTNSSSEPEREF")
11549         self.assertEqual(record.rounds[0].alignments[26].hsps[0].query_start, 610)
11550         self.assertEqual(record.rounds[0].alignments[26].hsps[0].query_end, 685)
11551         self.assertEqual(record.rounds[0].alignments[26].hsps[0].sbjct_start, 435)
11552         self.assertEqual(record.rounds[0].alignments[26].hsps[0].sbjct_end, 506)
11553         self.assertEqual(record.rounds[1].alignments[0].hsps[0].query, "MMSARGDFLNYALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQALIYWIKAMNQQTTLDTPQXXXXXXXXXXXXGIXXXXXXXXXXXXTSQSATLNDKDDESLPAETGQNHPFFRRSDSMTFLGCIPPNPFEVPLAEAIPLADQPHLLQPNARKEDLFGRPSQGLYSSSAGSGKCLVEVTMDRNCLEVLPTKMSYAANLKNVMNMQNRQKKAGEDQSMLAEEADSSKPGPSAHDVAAQLKSSLLAEIGLTESEGPPLTSFRPQCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKESKFRREMEKLRNQQSRDLSLEVDRDRDLLIQQTMRQLNNHFGRRCATTPMAVHRVKVTFKDEPGEGSGVARSFYTAIAQAFLSNEKLPNLDCIQNANKGTHTSLMQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSIDTRPFRPASEGNPSDDPDPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGAXXXXXXXXXXXXEKVQENRKRHGSSRSVVXXXXXXXXXXXXNAPLFYQPGKRGFYTPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVPXXXXXXXXXXXXXXXXXXXNFGFV")
11554         self.assertEqual(record.rounds[1].alignments[0].hsps[0].match, "MMSARGDFLNYALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQALIYWIKAMNQQTTLDTPQ            GI            TSQSATLNDKDDESLPAETGQNHPFFRRSDSMTFLGCIPPNPFEVPLAEAIPLADQPHLLQPNARKEDLFGRPSQGLYSSSAGSGKCLVEVTMDRNCLEVLPTKMSYAANLKNVMNMQNRQKKAGEDQSMLAEEADSSKPGPSAHDVAAQLKSSLLAEIGLTESEGPPLTSFRPQCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKESKFRREMEKLRNQQSRDLSLEVDRDRDLLIQQTMRQLNNHFGRRCATTPMAVHRVKVTFKDEPGEGSGVARSFYTAIAQAFLSNEKLPNLDCIQNANKGTHTSLMQ                                      QLSIDTRPFRPASEGNPSDDPDPLPAHRQALGERLYPRVQAMQPAFASKITGM                   RARVEEAMELIVAHGRENGA            EKVQENRKRHGSSRSVV            NAPLFYQPGKRGFYTPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVP                   NFGFV")
11555         self.assertEqual(record.rounds[1].alignments[0].hsps[0].sbjct, "MMSARGDFLNYALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQALIYWIKAMNQQTTLDTPQLERKRTRELLELGIDNEDSEHENDDDTSQSATLNDKDDESLPAETGQNHPFFRRSDSMTFLGCIPPNPFEVPLAEAIPLADQPHLLQPNARKEDLFGRPSQGLYSSSAGSGKCLVEVTMDRNCLEVLPTKMSYAANLKNVMNMQNRQKKAGEDQSMLAEEADSSKPGPSAHDVAAQLKSSLLAEIGLTESEGPPLTSFRPQCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKESKFRREMEKLRNQQSRDLSLEVDRDRDLLIQQTMRQLNNHFGRRCATTPMAVHRVKVTFKDEPGEGSGVARSFYTAIAQAFLSNEKLPNLDCIQNANKGTHTSLMQRLRNRGERDREREREREMRRSSGLRAGSRRDRDRDFRRQLSIDTRPFRPASEGNPSDDPDPLPAHRQALGERLYPRVQAMQPAFASKITGMLLELSPAQLLLLLASEDSLRARVEEAMELIVAHGRENGADSILDLGLLDSSEKVQENRKRHGSSRSVVDMDLDDTDDGDDNAPLFYQPGKRGFYTPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVPLYSSKQILKQKLLLAIKTKNFGFV")
11556         self.assertEqual(record.rounds[1].alignments[0].hsps[0].query_start, 1)
11557         self.assertEqual(record.rounds[1].alignments[0].hsps[0].query_end, 889)
11558         self.assertEqual(record.rounds[1].alignments[0].hsps[0].sbjct_start, 1)
11559         self.assertEqual(record.rounds[1].alignments[0].hsps[0].sbjct_end, 889)
11560         self.assertEqual(record.rounds[1].alignments[1].hsps[0].query, "QCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKESKFRREMEKLRNQQSRDLSL-EVDRDRDLLIQQTMRQLNNHFGR--RCATTPMAVHRVKVTFKDEPGEGSGVARSFYTAIAQAFLSNEKLPNLDCIQNANKGTHTSLMQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSIDTRPFRPASEGN---PSDDPDPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGAXXXXXXXXXXXXEKVQENRKRHGSSRSVVXXXXXXXXXXXXNAPLFYQPGKRGFYTPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRM-LVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKL-LQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVPXXXXXXXXXXXXXXXXXXXNFGFV")
11561         self.assertEqual(record.rounds[1].alignments[1].hsps[0].match, "Q +F G+   + +L  +  L+L+LFGR FM+DVG E GS+L EL GF VKE +FRR MEKLRN Q RDL L +++R+R+ LI QT ++LN  FG   R    P+  +RVKVTFKDEPGEGSGVARSFYT+IA+A L++ K+PNL+ +Q      H+  +                                        L++D RP+ P +  +   P    D L  H Q +GERLYP++ ++    A KITGM                   R +V EA+E+I    +   +               Q ++ +   S  VV            N PLFY PGKRGFY PR G  +  R+N FRNIGR++GLCLLQNEL P+ L RHV+K +L RK+ +HD AFFDP +YES RQ+I  +Q+ + +   + M+L F +DL KEEG G  ELIP G ++ V+ + +Y       ++   +   E+ L A++ G+ DVLP NS+ +LTAED RLL+NG G++NV  LIS+T+FNDES E  +KL  +FK+WFWSIVE+M++ ERQ LVYFWT SP+LPASEEGFQP+PS+TIRP DD HLPTANTCISRLY+P                   NFGFV")
11562         self.assertEqual(record.rounds[1].alignments[1].hsps[0].sbjct, "QSNFSGIAPCNFLLSAK--LTLDLFGRPFMDDVGMEHGSVLPELRGFPVKEMRFRRHMEKLRNGQQRDLVLCKLERNRESLIVQTFKELNTQFGNQSRRIQPPITFNRVKVTFKDEPGEGSGVARSFYTSIAEALLASAKIPNLESVQVGTN--HSKYVVPFSSILRTTVSGSSRDQSTLQRRGSNSKILWRSARERKALNLDARPYTPPNSSDNATPESLNDHLSVHLQQIGERLYPKIHSINQTHAPKITGMLLEIPTPQLLSVISSDETLRQKVNEAIEIITFKQKSETSA--------------QSSQPKKSPSVVVVDPVDDD------NEPLFYSPGKRGFYIPRQGFASFERINAFRNIGRLIGLCLLQNELLPLFLQRHVLKYILRRKIKFHDLAFFDPALYESFRQIIQNAQTKEGEETINRMELCFVIDLMKEEGCGNRELIPGGRDV-VSHRVIYSSTSDAIQNIDXIKSQEKALEALKDGVFDVLPDNSMINLTAEDLRLLLNGVGDINVSTLISYTTFNDESSEGPDKLX-KFKKWFWSIVEKMNIMERQHLVYFWTGSPALPASEEGFQPLPSVTIRPADDSHLPTANTCISRLYIPLYSSKSILRSKMLMAIKSKNFGFV")
11563         self.assertEqual(record.rounds[1].alignments[1].hsps[0].query_start, 263)
11564         self.assertEqual(record.rounds[1].alignments[1].hsps[0].query_end, 889)
11565         self.assertEqual(record.rounds[1].alignments[1].hsps[0].sbjct_start, 2287)
11566         self.assertEqual(record.rounds[1].alignments[1].hsps[0].sbjct_end, 2895)
11567         self.assertEqual(record.rounds[1].alignments[1].hsps[1].query, "SARGDFLNYALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQALIYWIKAMNQQTTLDTPQXXXXXXXXXXXXGIXXXXXXXXXXXXTSQSATLNDKDDE------SLPA--ETGQNHPFFRRSDSMTFLGCIPPNPFEVPLAEAIPLADQPHLLQPNARKEDLFGRPSQGLYSSSAGSGKCLVEVTMD---RNCLEVLPTKMSYAANLK")
11568         self.assertEqual(record.rounds[1].alignments[1].hsps[1].match, "++R DF  Y LSLMRSH  EH D LPVLD+ +L+H+AYV  A +Y+++  N     D                I              + A L + + +      S+P+  +  + H FF RS+S   LGC  P  FE+PL  A+PLAD+PHLLQPN+++++LF      + +++  SG      T D    +  +  PT++ ++ +LK")
11569         self.assertEqual(record.rounds[1].alignments[1].hsps[1].sbjct, "NSRRDFFTYCLSLMRSHTSEHRDALPVLDITALRHIAYVLDAFVYYMR--NDSGFYDKQDSISGR--------INNLSPMTESYDTDDELANLEEFNADVQMSASSMPSGSQGTRRHAFFARSESTLTLGCSAPEGFELPLDMAMPLADKPHLLQPNSKRQELFANLPLLVTTNANNSG-----ATNDGDGASIFDYTPTRLGFSNSLK")
11570         self.assertEqual(record.rounds[1].alignments[1].hsps[1].query_start, 3)
11571         self.assertEqual(record.rounds[1].alignments[1].hsps[1].query_end, 200)
11572         self.assertEqual(record.rounds[1].alignments[1].hsps[1].sbjct_start, 1913)
11573         self.assertEqual(record.rounds[1].alignments[1].hsps[1].sbjct_end, 2106)
11574         self.assertEqual(record.rounds[1].alignments[2].hsps[0].query, "PRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQV---ELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLP----ASEEGFQPMPSITIRP-PDDQHLPTANTCISRLYVP")
11575         self.assertEqual(record.rounds[1].alignments[2].hsps[0].match, "P  G   E  L+ F+ IGR+ G+ +   +L      R   K++L + +  HD    D   Y SLR ++    +         +DL F +D   EE  GQ    EL   G  I VT +N  EY+    + R +   ++ + A ++G  +++P++ ++     +  LL+ G G+V+V      T + +    N     Q  +WFW  V  M   +R  L+ F T +  +P    A   G     S T+      + LP A+TC +RL +P")
11576         self.assertEqual(record.rounds[1].alignments[2].hsps[0].sbjct, "PNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHDMESVDSEYYNSLRWILENDPTE--------LDLRFIID---EELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSANH----QVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLP")
11577         self.assertEqual(record.rounds[1].alignments[2].hsps[0].query_start, 606)
11578         self.assertEqual(record.rounds[1].alignments[2].hsps[0].query_end, 865)
11579         self.assertEqual(record.rounds[1].alignments[2].hsps[0].sbjct_start, 649)
11580         self.assertEqual(record.rounds[1].alignments[2].hsps[0].sbjct_end, 901)
11581         self.assertEqual(record.rounds[1].alignments[3].hsps[0].query, "PRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASE----EGFQPMPSITIR-PPDDQHLPTANTCISRLYVP")
11582         self.assertEqual(record.rounds[1].alignments[3].hsps[0].match, "P  G N E  LN F+ IGR++GL +               K++L +KV   D    D   Y SL  ++    +   D  FS  D  F   +        ++L PNG NI VT +N  EYV      R+    E+  +A  +G  +++P+  +      +  LL+ G  E++++     T +   S  +     Q  +WFW +++  S  ++  L+ F T +  +P +     +G       TI    +   LP A+TC +RL +P")
11583         self.assertEqual(record.rounds[1].alignments[3].hsps[0].sbjct, "PHSGINPE-HLNYFKFIGRVIGLAIFHRRFVDAFFVVSFYKMILQKKVTLQDMESMDAEYYRSLVWILDNDITGVLDLTFSVEDNCFGEVVT-------IDLKPNGRNIEVTEENKREYVDLVTVWRIQKRIEEQFNAFHEGFSELIPQELINVFDERELELLIGGISEIDMEDWKKHTDYRSYSEND-----QIIKWFWELMDEWSNEKKSRLLQFTTGTSRIPVNGFKDLQGSDGPRKFTIEKAGEPNKLPKAHTCFNRLDLP")
11584         self.assertEqual(record.rounds[1].alignments[3].hsps[0].query_start, 606)
11585         self.assertEqual(record.rounds[1].alignments[3].hsps[0].query_end, 865)
11586         self.assertEqual(record.rounds[1].alignments[3].hsps[0].sbjct_start, 491)
11587         self.assertEqual(record.rounds[1].alignments[3].hsps[0].sbjct_end, 742)
11588         self.assertEqual(record.rounds[1].alignments[4].hsps[0].query, "PRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQV---ELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLP----ASEEGFQPMPSITIRP-PDDQHLPTANTCISRLYVP")
11589         self.assertEqual(record.rounds[1].alignments[4].hsps[0].match, "P  G   E  L+ F+ IGR+ G+ +   +L      R   K++L + +  HD    D   Y SLR ++    +         +DL F +D   EE  GQ    EL   G  I VT +N  EY+    + R +   ++ + A ++G  +++P++ ++     +  LL+ G G+V+V      T + +    N     Q   WFW  V  M   +R  L+ F T +  +P    A   G     S T+        LP A+TC +RL +P")
11590         self.assertEqual(record.rounds[1].alignments[4].hsps[0].sbjct, "PNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLQKLITLHDMESVDSEYYSSLRWILENDPTE--------LDLRFIID---EELFGQTHQHELKTGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSMNH----QVIHWFWKAVWMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPDKLPRAHTCFNRLDLP")
11591         self.assertEqual(record.rounds[1].alignments[4].hsps[0].query_start, 606)
11592         self.assertEqual(record.rounds[1].alignments[4].hsps[0].query_end, 865)
11593         self.assertEqual(record.rounds[1].alignments[4].hsps[0].sbjct_start, 679)
11594         self.assertEqual(record.rounds[1].alignments[4].hsps[0].sbjct_end, 931)
11595         self.assertEqual(record.rounds[1].alignments[5].hsps[0].query, "PRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASE----EGFQPMPSITIRPPDD-QHLPTANTCISRLYVP")
11596         self.assertEqual(record.rounds[1].alignments[5].hsps[0].match, "P  G N E  LN F+ IGR++GL +             + K++L +KV   D    D  +Y SL  ++  S     D  FSA D  F   +        V+L P+G NI VT  N  EYV  Y + R++   ++   A   G  +++P++ +      +  LL+ G  E++++     T +      +     +  +WFW  V      +R  L+ F T +  +P +     +G       TI    + Q LP ++TC +R+ +P")
11597         self.assertEqual(record.rounds[1].alignments[5].hsps[0].sbjct, "PNSGINPE-HLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKMMLRKKVVLQDMEGVDAEVYNSLNWMLENSIDGVLDLTFSADDERFGEVVT-------VDLKPDGRNIEVTDGNKKEYVELYTQWRIVDRVQEQFKAFMDGFNELIPEDLVTVFDERELELLIGGIAEIDIEDWKKHTDYRGYQESD-----EVIQWFWKCVSEWDNEQRARLLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKAGEVQQLPKSHTCFNRVDLP")
11598         self.assertEqual(record.rounds[1].alignments[5].hsps[0].query_start, 606)
11599         self.assertEqual(record.rounds[1].alignments[5].hsps[0].query_end, 865)
11600         self.assertEqual(record.rounds[1].alignments[5].hsps[0].sbjct_start, 533)
11601         self.assertEqual(record.rounds[1].alignments[5].hsps[0].sbjct_end, 784)
11602         self.assertEqual(record.rounds[1].alignments[6].hsps[0].query, "FRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQV-ELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLED-LTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVP")
11603         self.assertEqual(record.rounds[1].alignments[6].hsps[0].match, "F  IG +LGL +  N +  +     V + L+G+K  + D     PV+Y+SL+ L+    + + D     M + F +      G   + +L  NG  IP+T +N  E+V  Y+++ +    E+   A R+G   V  ++ L+     E+  LL+ G   ++ Q L   T +  + G   + +L   R FW IV   +  +++  + F T +   P    G   M  I    PD + LPT++TC + L +P")
11604         self.assertEqual(record.rounds[1].alignments[6].hsps[0].sbjct, "FTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGNVEDD-----MMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEY--DGGYTRDSVL--IREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKM-IIAKNGPDTERLPTSHTCFNVLLLP")
11605         self.assertEqual(record.rounds[1].alignments[6].hsps[0].query_start, 619)
11606         self.assertEqual(record.rounds[1].alignments[6].hsps[0].query_end, 865)
11607         self.assertEqual(record.rounds[1].alignments[6].hsps[0].sbjct_start, 612)
11608         self.assertEqual(record.rounds[1].alignments[6].hsps[0].sbjct_end, 850)
11609         self.assertEqual(record.rounds[1].alignments[7].hsps[0].query, "FRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQV-ELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLED-LTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVP")
11610         self.assertEqual(record.rounds[1].alignments[7].hsps[0].match, "F  IG + GL +  N +  +     V + L+G+K  + D     PV+Y+SL+ L+    S + D     M + F +      G   + +L  NG  IP+T +N  E+V  Y+++ +    E+   A R+G   V  ++ L+     E+  LL+ G   ++ Q L   T +  + G   E ++   R FW IV   +  +++  + F T +   P    G   M  I    PD + LPT++TC + L +P")
11611         self.assertEqual(record.rounds[1].alignments[7].hsps[0].sbjct, "FTLIGIL-GLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGSVEDD-----MMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVISYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEY--DGGYTRESVV--IREFWEIVHSFTDEQKRLFLLFTTGTDRAPVGGLGKLKM-IIAKNGPDTERLPTSHTCFNVLLLP")
11612         self.assertEqual(record.rounds[1].alignments[7].hsps[0].query_start, 619)
11613         self.assertEqual(record.rounds[1].alignments[7].hsps[0].query_end, 865)
11614         self.assertEqual(record.rounds[1].alignments[7].hsps[0].sbjct_start, 623)
11615         self.assertEqual(record.rounds[1].alignments[7].hsps[0].sbjct_end, 860)
11616         self.assertEqual(record.rounds[1].alignments[8].hsps[0].query, "YTPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAV------DLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPK-NSLEDLTAEDFRLLVNGCGE---VNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYV")
11617         self.assertEqual(record.rounds[1].alignments[8].hsps[0].match, "+    GKN++  L  +   G ++GL +  + +  +   + + K L    +++ D++   P    +L +++  ++ +  D      +  +        D    +    VEL  NG N+P+T  N +E+V K+ E  +    E   +    G   V  + NS++   +E+   LV G  E    + + L S T +     +++  +     WFW I+E      ++ L+ F T+S  +PA+     P     +   D   LP A+TC + + +")
11618         self.assertEqual(record.rounds[1].alignments[8].hsps[0].sbjct, "FDKSKGKNSQLEL--YYLFGVVMGLAIFNSTILDLQFPKALYKKLCSEPLSFEDYSELFPETSRNLIKMLNYTEDNFEDVFSLTFETTYRNNNWILNDSKSSKEYVTVELCENGRNVPITQSNKHEFVMKWVEFYLEKSIEPQYNKFVSGFKRVFAECNSIKLFNSEELERLVCGDEEQTKFDFKSLRSVTKYVGGFSDDSRAVC----WFWEIIESWDYPLQKKLLQFVTASDRIPATGISTIPFKISLLGSHDSDDLPLAHTCFNEICL")
11619         self.assertEqual(record.rounds[1].alignments[8].hsps[0].query_start, 604)
11620         self.assertEqual(record.rounds[1].alignments[8].hsps[0].query_end, 864)
11621         self.assertEqual(record.rounds[1].alignments[8].hsps[0].sbjct_start, 602)
11622         self.assertEqual(record.rounds[1].alignments[8].hsps[0].sbjct_end, 866)
11623         self.assertEqual(record.rounds[1].alignments[9].hsps[0].query, "GRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQV-ELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLP----ASEEGFQPMPSITIRPPD--DQHLPTANTCISRLYVP")
11624         self.assertEqual(record.rounds[1].alignments[9].hsps[0].match, "GR +   ++   L      R   K +LG+ V + D    D   Y+ L  L+        D      DL F+ ++ +E G  +V +L PNG NI VT +N  EYV    + RM     + L A  +G  +++PK  +   T ++  LL  G   +++  L S T ++     + +      +WFW  +      +R   + F T +  +P    A+ EG   +    I   D     LP+A+TC ++L +P")
11625         self.assertEqual(record.rounds[1].alignments[9].hsps[0].sbjct, "GRYVAKAVMTTALLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLEN------DVSTLGYDLTFSTEV-QEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLYTGLPTIDIDDLKSNTEYHKYQSNSIQ-----IQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLP")
11626         self.assertEqual(record.rounds[1].alignments[9].hsps[0].query_start, 623)
11627         self.assertEqual(record.rounds[1].alignments[9].hsps[0].query_end, 865)
11628         self.assertEqual(record.rounds[1].alignments[9].hsps[0].sbjct_start, 45)
11629         self.assertEqual(record.rounds[1].alignments[9].hsps[0].sbjct_end, 282)
11630         self.assertEqual(record.rounds[1].alignments[10].hsps[0].query, "TPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNW--HDFAFFDPVMYES---LRQLILASQSSDADAVFSAMDLAFAVDL-----CKEE---------GGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRP------PDDQHLPTANTCISRLYVP")
11631         self.assertEqual(record.rounds[1].alignments[10].hsps[0].match, "T +P    + ++  FR +G+++   ++   L  + L     K +L ++ +   HD    DPV+  S   L  ++   +  + D   +   L +A++      C  E         G   +EL   G +IPVT  N+ EY+R      +     +   + R G   V P + L+    E+   L+ G                 + G   +   +  ++ + I+      +++  + F T SP LP         P   +R         D  LP+  TC++ L +P")
11632         self.assertEqual(record.rounds[1].alignments[10].hsps[0].sbjct, "TAKPAHIAKVKMK-FRFLGKLMAKAIMDFRLVDLPLGLPFYKWMLRQETSLTSHDLFDIDPVVARSVYHLEDIVRQKKRLEQDKSQTKESLQYALETLTMNGCSVEDLGLDFTLPGFPNIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVSRQFDSFRDGFESVFPLSHLQYFYPEELDQLLCGSKADTWDAKTLMECCRPDHGYTHDS--RAVKFLFEILSSFDNEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLKLP")
11633         self.assertEqual(record.rounds[1].alignments[10].hsps[0].query_start, 605)
11634         self.assertEqual(record.rounds[1].alignments[10].hsps[0].query_end, 865)
11635         self.assertEqual(record.rounds[1].alignments[10].hsps[0].sbjct_start, 1684)
11636         self.assertEqual(record.rounds[1].alignments[10].hsps[0].sbjct_end, 1966)
11637         self.assertEqual(record.rounds[1].alignments[11].hsps[0].query, "EARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGG--QVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPS-ITIRPPDDQHLPTANTCISRLYVP")
11638         self.assertEqual(record.rounds[1].alignments[11].hsps[0].match, "    N F  IG   GL +  + +  +     + K LL  K    D     P    SL++L+      D +  F    L F +  C+E  G   Q +LIP G N+ V   N  E+V  Y  +   +   +   A   G L V     LE     + R ++ G    N + L     +  +       +    + FW       + +++  + F T S  +P    G   +   I      +++LP A+TC + L +P")
11639         self.assertEqual(record.rounds[1].alignments[11].hsps[0].sbjct, "FVEHNWFHLIGITCGLAIYNSTVVDLHFPLALYKKLLNVKPGLEDLKELSPTEGRSLQELLDY-PGEDVEETFC---LNFTI--CRESYGVIEQKKLIPGGDNVTVCKDNRQEFVDAYVNYVFQISVHEWYTAFSSGFLKVCGGKVLELFQPSELRAMMVGNSNYNWEELEETAIYKGDYSATHPTV----KLFWETFHEFPLEKKKKFLLFLTGSDRIPI--YGMASLQIVIQSTASGEEYLPVAHTCYNLLDLP")
11640         self.assertEqual(record.rounds[1].alignments[11].hsps[0].query_start, 613)
11641         self.assertEqual(record.rounds[1].alignments[11].hsps[0].query_end, 865)
11642         self.assertEqual(record.rounds[1].alignments[11].hsps[0].sbjct_start, 782)
11643         self.assertEqual(record.rounds[1].alignments[11].hsps[0].sbjct_end, 1025)
11644         self.assertEqual(record.rounds[1].alignments[12].hsps[0].query, "RLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLL----GRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGE-VNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPM-PSITIRPPDDQ--HLPTANTCISRLYVP")
11645         self.assertEqual(record.rounds[1].alignments[12].hsps[0].match, "+L     +G+++G CL ++ L  ++     +K LL    G   ++ D   +D V+Y +L +L+    ++D      ++DL F +D   E     V+LIPNG    VT  NV  YV K  ++++     +P+ A   GL  ++  + +E   + + ++L++G  + +++  L S T +     E+     Q    FW ++      E+ + + F TS P  P   +GF+ + P   IR    +   LPTA+TC++ L +P")
11646         self.assertEqual(record.rounds[1].alignments[12].hsps[0].sbjct, "KLKYIWFLGKVVGKCLYEHVLIDVSFADFFLKKLLNYSNGFLSSFSDLGSYDSVLYNNLIKLLN--MTTDE---IKSLDLTFEIDE-PESSAKVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWMEMFNSIELQMLISGERDNIDLDDLKSNTEYGGYKEED-----QTIVDFWEVLNEFKFEEKLNFLKFVTSVPQAP--LQGFKALDPKFGIRNAGTEKYRLPTASTCVNLLKLP")
11647         self.assertEqual(record.rounds[1].alignments[12].hsps[0].query_start, 615)
11648         self.assertEqual(record.rounds[1].alignments[12].hsps[0].query_end, 865)
11649         self.assertEqual(record.rounds[1].alignments[12].hsps[0].sbjct_start, 640)
11650         self.assertEqual(record.rounds[1].alignments[12].hsps[0].sbjct_end, 885)
11651         self.assertEqual(record.rounds[1].alignments[13].hsps[0].query, "RPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLG------------RKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLP-ASEEGFQPMPSITIRPPD-----DQHLPTANTCISRLYVP")
11652         self.assertEqual(record.rounds[1].alignments[13].hsps[0].match, " P  N E  +  F  +G  +   LL N +     ++   ++L               +         DP++ +SL+ ++      D +    ++ L F V      G   +ELIP G N  +   NV EY+    +  +    E+ L A  +G   V     +  L  ++  + + G  E +  M   +T+ N E G   +  +     F SI+      ER+  + F T SP LP    +   P  ++ ++  +     D++LP+  TC + L +P")
11653         self.assertEqual(record.rounds[1].alignments[13].hsps[0].sbjct, "NPFSNNEKVIELFGYLGTFVARSLLDNRILDFRFSKVFFELLHRMSTPNVTTVPSDVETCLLMIELVDPLLAKSLKYIVAN---KDDNMTLESLSLTFTVP-----GNDDIELIPGGCNKSLNSSNVEEYIHGVIDQILGKGIEKQLKAFIEGFSKVFSYERMLILFPDEL-VDIFGRVEEDWSMATLYTNLNAEHGYTMDSSI--IHDFISIISAFGKHERRLFLQFLTGSPKLPIGGFKSLNPKFTVVLKHAEDGLTADEYLPSVMTCANYLKLP")
11654         self.assertEqual(record.rounds[1].alignments[13].hsps[0].query_start, 607)
11655         self.assertEqual(record.rounds[1].alignments[13].hsps[0].query_end, 865)
11656         self.assertEqual(record.rounds[1].alignments[13].hsps[0].sbjct_start, 1192)
11657         self.assertEqual(record.rounds[1].alignments[13].hsps[0].sbjct_end, 1457)
11658         self.assertEqual(record.rounds[1].alignments[14].hsps[0].query, "PLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGA")
11659         self.assertEqual(record.rounds[1].alignments[14].hsps[0].match, "P    +Q LGERL+P +QAM P  A KITGM                   R++V+EA+ ++ AH  +  A")
11660         self.assertEqual(record.rounds[1].alignments[14].hsps[0].sbjct, "PPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAA")
11661         self.assertEqual(record.rounds[1].alignments[14].hsps[0].query_start, 480)
11662         self.assertEqual(record.rounds[1].alignments[14].hsps[0].query_end, 549)
11663         self.assertEqual(record.rounds[1].alignments[14].hsps[0].sbjct_start, 554)
11664         self.assertEqual(record.rounds[1].alignments[14].hsps[0].sbjct_end, 623)
11665         self.assertEqual(record.rounds[1].alignments[15].hsps[0].query, "PLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGA")
11666         self.assertEqual(record.rounds[1].alignments[15].hsps[0].match, "P    +Q LGERL+P +QAM P  A KITGM                   R +V+EA+ ++ AH  +  A")
11667         self.assertEqual(record.rounds[1].alignments[15].hsps[0].sbjct, "PPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRLKVDEAVAVLQAHQAKEAA")
11668         self.assertEqual(record.rounds[1].alignments[15].hsps[0].query_start, 480)
11669         self.assertEqual(record.rounds[1].alignments[15].hsps[0].query_end, 549)
11670         self.assertEqual(record.rounds[1].alignments[15].hsps[0].sbjct_start, 552)
11671         self.assertEqual(record.rounds[1].alignments[15].hsps[0].sbjct_end, 621)
11672         self.assertEqual(record.rounds[1].alignments[16].hsps[0].query, "PLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGA")
11673         self.assertEqual(record.rounds[1].alignments[16].hsps[0].match, "P    +Q LGERL+P +QAM P+ A KITGM                   R++V+EA+ ++ AH  +  A")
11674         self.assertEqual(record.rounds[1].alignments[16].hsps[0].sbjct, "PPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAA")
11675         self.assertEqual(record.rounds[1].alignments[16].hsps[0].query_start, 480)
11676         self.assertEqual(record.rounds[1].alignments[16].hsps[0].query_end, 549)
11677         self.assertEqual(record.rounds[1].alignments[16].hsps[0].sbjct_start, 554)
11678         self.assertEqual(record.rounds[1].alignments[16].hsps[0].sbjct_end, 623)
11679         self.assertEqual(record.rounds[1].alignments[17].hsps[0].query, "PDPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGA")
11680         self.assertEqual(record.rounds[1].alignments[17].hsps[0].match, "       +Q LGERLYP ++ M    A KITGM                   +A+VEEA+ ++  H     A")
11681         self.assertEqual(record.rounds[1].alignments[17].hsps[0].sbjct, "NAKPQEQKQILGERLYPMIEHMHANLAGKITGMLLEIENSELLHMIEDQEALKAKVEEAVAVLQVHRVTEPA")
11682         self.assertEqual(record.rounds[1].alignments[17].hsps[0].query_start, 478)
11683         self.assertEqual(record.rounds[1].alignments[17].hsps[0].query_end, 549)
11684         self.assertEqual(record.rounds[1].alignments[17].hsps[0].sbjct_start, 560)
11685         self.assertEqual(record.rounds[1].alignments[17].hsps[0].sbjct_end, 631)
11686         self.assertEqual(record.rounds[1].alignments[18].hsps[0].query, "PLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIV")
11687         self.assertEqual(record.rounds[1].alignments[18].hsps[0].match, "P  + +Q LGE LYP+V   +   + KITGM                     RV EA+ ++ ")
11688         self.assertEqual(record.rounds[1].alignments[18].hsps[0].sbjct, "PEESRKQVLGELLYPKVFVREEKLSGKITGMLLEMPNSELLELLEDDSALNERVNEAIGVLQ")
11689         self.assertEqual(record.rounds[1].alignments[18].hsps[0].query_start, 480)
11690         self.assertEqual(record.rounds[1].alignments[18].hsps[0].query_end, 541)
11691         self.assertEqual(record.rounds[1].alignments[18].hsps[0].sbjct_start, 581)
11692         self.assertEqual(record.rounds[1].alignments[18].hsps[0].sbjct_end, 642)
11693         self.assertEqual(record.rounds[1].alignments[19].hsps[0].query, "PDPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELI")
11694         self.assertEqual(record.rounds[1].alignments[19].hsps[0].match, "       R  LGE LYP V+ ++   A+K+TGM                   +A+V EAM+++")
11695         self.assertEqual(record.rounds[1].alignments[19].hsps[0].sbjct, "NATPEQQRTMLGEVLYPLVEQVEAESAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVL")
11696         self.assertEqual(record.rounds[1].alignments[19].hsps[0].query_start, 478)
11697         self.assertEqual(record.rounds[1].alignments[19].hsps[0].query_end, 540)
11698         self.assertEqual(record.rounds[1].alignments[19].hsps[0].sbjct_start, 549)
11699         self.assertEqual(record.rounds[1].alignments[19].hsps[0].sbjct_end, 611)
11700         self.assertEqual(record.rounds[1].alignments[20].hsps[0].query, "LPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELI")
11701         self.assertEqual(record.rounds[1].alignments[20].hsps[0].match, "   H + LG+ LYP V+  +PA  +K+TGM                   +A+V EA++++")
11702         self.assertEqual(record.rounds[1].alignments[20].hsps[0].sbjct, "PDKHPRMLGDHLYPLVEQQEPANPAKVTGMLLEMDQAEILHLLESPEALKAKVSEALDVL")
11703         self.assertEqual(record.rounds[1].alignments[20].hsps[0].query_start, 481)
11704         self.assertEqual(record.rounds[1].alignments[20].hsps[0].query_end, 540)
11705         self.assertEqual(record.rounds[1].alignments[20].hsps[0].sbjct_start, 587)
11706         self.assertEqual(record.rounds[1].alignments[20].hsps[0].sbjct_end, 646)
11707         self.assertEqual(record.rounds[1].alignments[21].hsps[0].query, "PASEGNPSDDPDP----LPAHRQALGERLYPRVQA--MQPAFASKITGM")
11708         self.assertEqual(record.rounds[1].alignments[21].hsps[0].match, "P   G P +  D         RQALGE+LY +V A       A KITGM")
11709         self.assertEqual(record.rounds[1].alignments[21].hsps[0].sbjct, "PPQGGFPRNANDNNQFYQQKQRQALGEQLYKKVSAKTSNEEAAGKITGM")
11710         self.assertEqual(record.rounds[1].alignments[21].hsps[0].query_start, 468)
11711         self.assertEqual(record.rounds[1].alignments[21].hsps[0].query_end, 510)
11712         self.assertEqual(record.rounds[1].alignments[21].hsps[0].sbjct_start, 484)
11713         self.assertEqual(record.rounds[1].alignments[21].hsps[0].sbjct_end, 532)
11714         self.assertEqual(record.rounds[1].alignments[22].hsps[0].query, "SAMDLAFAVDLCKEEGGGQ---VELIPNGVNIPVTPQNVYEYVRKY-AEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCG")
11715         self.assertEqual(record.rounds[1].alignments[22].hsps[0].match, "    L F +D  K         +EL P G            YV      + +    E    A ++G     P  +L  L  E     +    ")
11716         self.assertEqual(record.rounds[1].alignments[22].hsps[0].sbjct, "LREQLCFTIDPEKAGDFDDAVAIELTPEGY--------YKLYVHIADVSYYVREGTETDKEAYKRGFTYYFPDRALHML-PEKLSAKLCSLR")
11717         self.assertEqual(record.rounds[1].alignments[22].hsps[0].query_start, 686)
11718         self.assertEqual(record.rounds[1].alignments[22].hsps[0].query_end, 773)
11719         self.assertEqual(record.rounds[1].alignments[22].hsps[0].sbjct_start, 243)
11720         self.assertEqual(record.rounds[1].alignments[22].hsps[0].sbjct_end, 325)
11721         self.assertEqual(record.rounds[1].alignments[23].hsps[0].query, "LAEEADSSKPGPSAHDVAAQLKSSLLAEIGLTESEGPPLTSFRPQCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKE")
11722         self.assertEqual(record.rounds[1].alignments[23].hsps[0].match, "+A +  S+  GP +      ++ S  A++   E+  P  T  RP  +  G V S      +W    E   R F         S  + L  F+  E")
11723         self.assertEqual(record.rounds[1].alignments[23].hsps[0].sbjct, "VASQYSSTPSGPVSVSAMRAVQRSFSAQLAHNEARQPEPTYLRPVSTSYGPVPSTQSAQEQWYSPTEAQFRAFTAAHSMPTTSAQSPLTTFDTPE")
11724         self.assertEqual(record.rounds[1].alignments[23].hsps[0].query_start, 219)
11725         self.assertEqual(record.rounds[1].alignments[23].hsps[0].query_end, 313)
11726         self.assertEqual(record.rounds[1].alignments[23].hsps[0].sbjct_start, 702)
11727         self.assertEqual(record.rounds[1].alignments[23].hsps[0].sbjct_end, 796)
11728         self.assertEqual(record.rounds[1].alignments[24].hsps[0].query, "KRGFYTPRP-GKNTEARLNCFRN----IGRILGLCLLQNELC----PITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVN-IPVTPQNVY---EYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKN------------SLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMS")
11729         self.assertEqual(record.rounds[1].alignments[24].hsps[0].match, "KR F+  +   KN +  +  F      I  +  L LL  E+        + +   K       ++ D       + E        S + + D++           +  +        I  G     +   +     E++   +         +     RK     +                +      + +L  NG   ++   +                +      F   V++  ")
11730         self.assertEqual(record.rounds[1].alignments[24].hsps[0].sbjct, "KRNFHILKSLSKNEKETMRHFDFEMEWIIDLFSLSLLHGEMIFYEYDCNITK-FYK-------SFQDLWDMVIHISEKCYNYFFNSDALEVDSLTKFYTNRIVEIVANKVLVIVPAFILRGDRFKTIQYADKKKMIEFLYGVSSVYFNEFGFEYYRCFRKMFTAKIAYKILNRSCEKDAWRIILKFLLNELKLEDNGDSYIDYNDMRLN------------DICPIILEFQETVQKYD")
11731         self.assertEqual(record.rounds[1].alignments[24].hsps[0].query_start, 600)
11732         self.assertEqual(record.rounds[1].alignments[24].hsps[0].query_end, 812)
11733         self.assertEqual(record.rounds[1].alignments[24].hsps[0].sbjct_start, 523)
11734         self.assertEqual(record.rounds[1].alignments[24].hsps[0].sbjct_end, 740)
11735         self.assertEqual(record.rounds[1].alignments[25].hsps[0].query, "QLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPN-GVNIPVTPQNVYEYVRKYAE----------HRMLVVAEQPLHAMRK-------GLLDVLPKNSLEDLTAEDFRLLV")
11736         self.assertEqual(record.rounds[1].alignments[25].hsps[0].match, "+LI+    +        +D AF       E   ++ +  N GV I +T   V  YV +Y +          ++++      +  +++           ++ +  L+ L  +D R L+")
11737         self.assertEqual(record.rounds[1].alignments[25].hsps[0].sbjct, "ELIVNGIINGDLKTSLQVDAAFKYVKANGEASTKMGMNENSGVGIEITEDQVRNYVMQYIQENKERILTERYKLVPGIFADVKNLKELKWADPRSFKPIIDQEVLKLLGPKDERDLI")
11738         self.assertEqual(record.rounds[1].alignments[25].hsps[0].query_start, 671)
11739         self.assertEqual(record.rounds[1].alignments[25].hsps[0].query_end, 769)
11740         self.assertEqual(record.rounds[1].alignments[25].hsps[0].sbjct_start, 71)
11741         self.assertEqual(record.rounds[1].alignments[25].hsps[0].sbjct_end, 187)
11742         self.assertEqual(record.rounds[2].alignments[0].hsps[0].query, "MMSARGDFLNYALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQALIYWIKAMNQQTTLDTPQXXXXXXXXXXXXGIXXXXXXXXXXXXTSQSATLNDKDDESLPAETGQNHPFFRRSDSMTFLGCIPPNPFEVPLAEAIPLADQPHLLQPNARKEDLFGRPSQGLYSSSAGSGKCLVEVTMDRNCLEVLPTKMSYAANLKNVMNMQNRQKKAGEDQSMLAEEADSSKPGPSAHDVAAQLKSSLLAEIGLTESEGPPLTSFRPQCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKESKFRREMEKLRNQQSRDLSLEVDRDRDLLIQQTMRQLNNHFGRRCATTPMAVHRVKVTFKDEPGEGSGVARSFYTAIAQAFLSNEKLPNLDCIQNANKGTHTSLMQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSIDTRPFRPASEGNPSDDPDPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGAXXXXXXXXXXXXEKVQENRKRHGSSRSVVXXXXXXXXXXXXNAPLFYQPGKRGFYTPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVPXXXXXXXXXXXXXXXXXXXNFGFV")
11743         self.assertEqual(record.rounds[2].alignments[0].hsps[0].match, "MMSARGDFLNYALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQALIYWIKAMNQQTTLDTPQ            GI            TSQSATLNDKDDESLPAETGQNHPFFRRSDSMTFLGCIPPNPFEVPLAEAIPLADQPHLLQPNARKEDLFGRPSQGLYSSSAGSGKCLVEVTMDRNCLEVLPTKMSYAANLKNVMNMQNRQKKAGEDQSMLAEEADSSKPGPSAHDVAAQLKSSLLAEIGLTESEGPPLTSFRPQCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKESKFRREMEKLRNQQSRDLSLEVDRDRDLLIQQTMRQLNNHFGRRCATTPMAVHRVKVTFKDEPGEGSGVARSFYTAIAQAFLSNEKLPNLDCIQNANKGTHTSLMQ                                      QLSIDTRPFRPASEGNPSDDPDPLPAHRQALGERLYPRVQAMQPAFASKITGM                   RARVEEAMELIVAHGRENGA            EKVQENRKRHGSSRSVV            NAPLFYQPGKRGFYTPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVP                   NFGFV")
11744         self.assertEqual(record.rounds[2].alignments[0].hsps[0].sbjct, "MMSARGDFLNYALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQALIYWIKAMNQQTTLDTPQLERKRTRELLELGIDNEDSEHENDDDTSQSATLNDKDDESLPAETGQNHPFFRRSDSMTFLGCIPPNPFEVPLAEAIPLADQPHLLQPNARKEDLFGRPSQGLYSSSAGSGKCLVEVTMDRNCLEVLPTKMSYAANLKNVMNMQNRQKKAGEDQSMLAEEADSSKPGPSAHDVAAQLKSSLLAEIGLTESEGPPLTSFRPQCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKESKFRREMEKLRNQQSRDLSLEVDRDRDLLIQQTMRQLNNHFGRRCATTPMAVHRVKVTFKDEPGEGSGVARSFYTAIAQAFLSNEKLPNLDCIQNANKGTHTSLMQRLRNRGERDREREREREMRRSSGLRAGSRRDRDRDFRRQLSIDTRPFRPASEGNPSDDPDPLPAHRQALGERLYPRVQAMQPAFASKITGMLLELSPAQLLLLLASEDSLRARVEEAMELIVAHGRENGADSILDLGLLDSSEKVQENRKRHGSSRSVVDMDLDDTDDGDDNAPLFYQPGKRGFYTPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVPLYSSKQILKQKLLLAIKTKNFGFV")
11745         self.assertEqual(record.rounds[2].alignments[0].hsps[0].query_start, 1)
11746         self.assertEqual(record.rounds[2].alignments[0].hsps[0].query_end, 889)
11747         self.assertEqual(record.rounds[2].alignments[0].hsps[0].sbjct_start, 1)
11748         self.assertEqual(record.rounds[2].alignments[0].hsps[0].sbjct_end, 889)
11749         self.assertEqual(record.rounds[2].alignments[1].hsps[0].query, "QCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKESKFRREMEKLRNQQSRDLSL-EVDRDRDLLIQQTMRQLNNHFGR--RCATTPMAVHRVKVTFKDEPGEGSGVARSFYTAIAQAFLSNEKLPNLDCIQNANKGTHTSLMQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSIDTRPFRPASEGN---PSDDPDPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGAXXXXXXXXXXXXEKVQENRKRHGSSRSVVXXXXXXXXXXXXNAPLFYQPGKRGFYTPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRM-LVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLL-QFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVPXXXXXXXXXXXXXXXXXXXNFGFV")
11750         self.assertEqual(record.rounds[2].alignments[1].hsps[0].match, "Q +F G+   + +L  +  L+L+LFGR FM+DVG E GS+L EL GF VKE +FRR MEKLRN Q RDL L +++R+R+ LI QT ++LN  FG   R    P+  +RVKVTFKDEPGEGSGVARSFYT+IA+A L++ K+PNL+ +Q      H+  +                                        L++D RP+ P +  +   P    D L  H Q +GERLYP++ ++    A KITGM                   R +V EA+E+I    +   +               Q ++ +   S  VV            N PLFY PGKRGFY PR G  +  R+N FRNIGR++GLCLLQNEL P+ L RHV+K +L RK+ +HD AFFDP +YES RQ+I  +Q+ + +   + M+L F +DL KEEG G  ELIP G ++ V+ + +Y       ++   +   E+ L A++ G+ DVLP NS+ +LTAED RLL+NG G++NV  LIS+T+FNDES E  +K L +FK+WFWSIVE+M++ ERQ LVYFWT SP+LPASEEGFQP+PS+TIRP DD HLPTANTCISRLY+P                   NFGFV")
11751         self.assertEqual(record.rounds[2].alignments[1].hsps[0].sbjct, "QSNFSGIAPCNFLLSAK--LTLDLFGRPFMDDVGMEHGSVLPELRGFPVKEMRFRRHMEKLRNGQQRDLVLCKLERNRESLIVQTFKELNTQFGNQSRRIQPPITFNRVKVTFKDEPGEGSGVARSFYTSIAEALLASAKIPNLESVQVGTN--HSKYVVPFSSILRTTVSGSSRDQSTLQRRGSNSKILWRSARERKALNLDARPYTPPNSSDNATPESLNDHLSVHLQQIGERLYPKIHSINQTHAPKITGMLLEIPTPQLLSVISSDETLRQKVNEAIEIITFKQKSETSA--------------QSSQPKKSPSVVVVDPVDDD------NEPLFYSPGKRGFYIPRQGFASFERINAFRNIGRLIGLCLLQNELLPLFLQRHVLKYILRRKIKFHDLAFFDPALYESFRQIIQNAQTKEGEETINRMELCFVIDLMKEEGCGNRELIPGGRDV-VSHRVIYSSTSDAIQNIDXIKSQEKALEALKDGVFDVLPDNSMINLTAEDLRLLLNGVGDINVSTLISYTTFNDESSEGPDK-LXKFKKWFWSIVEKMNIMERQHLVYFWTGSPALPASEEGFQPLPSVTIRPADDSHLPTANTCISRLYIPLYSSKSILRSKMLMAIKSKNFGFV")
11752         self.assertEqual(record.rounds[2].alignments[1].hsps[0].query_start, 263)
11753         self.assertEqual(record.rounds[2].alignments[1].hsps[0].query_end, 889)
11754         self.assertEqual(record.rounds[2].alignments[1].hsps[0].sbjct_start, 2287)
11755         self.assertEqual(record.rounds[2].alignments[1].hsps[0].sbjct_end, 2895)
11756         self.assertEqual(record.rounds[2].alignments[1].hsps[1].query, "SARGDFLNYALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQALIYWIKAMNQQTTLDTPQXXXXXXXXXXXXGIXXXXXXXXXXXXTSQSATLNDKDDE------SLPA--ETGQNHPFFRRSDSMTFLGCIPPNPFEVPLAEAIPLADQPHLLQPNARKEDLFGRPSQGLYSSSAGSGKCLVEVTMD---RNCLEVLPTKMSYAANLK")
11757         self.assertEqual(record.rounds[2].alignments[1].hsps[1].match, "++R DF  Y LSLMRSH  EH D LPVLD+ +L+H+AYV  A +Y+++  N     D                I              + A L + + +      S+P+  +  + H FF RS+S   LGC  P  FE+PL  A+PLAD+PHLLQPN+++++LF      + +++  SG      T D    +  +  PT++ ++ +LK")
11758         self.assertEqual(record.rounds[2].alignments[1].hsps[1].sbjct, "NSRRDFFTYCLSLMRSHTSEHRDALPVLDITALRHIAYVLDAFVYYMR--NDSGFYDKQDSISGR--------INNLSPMTESYDTDDELANLEEFNADVQMSASSMPSGSQGTRRHAFFARSESTLTLGCSAPEGFELPLDMAMPLADKPHLLQPNSKRQELFANLPLLVTTNANNSG-----ATNDGDGASIFDYTPTRLGFSNSLK")
11759         self.assertEqual(record.rounds[2].alignments[1].hsps[1].query_start, 3)
11760         self.assertEqual(record.rounds[2].alignments[1].hsps[1].query_end, 200)
11761         self.assertEqual(record.rounds[2].alignments[1].hsps[1].sbjct_start, 1913)
11762         self.assertEqual(record.rounds[2].alignments[1].hsps[1].sbjct_end, 2106)
11763         self.assertEqual(record.rounds[2].alignments[2].hsps[0].query, "PRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASE----EGFQPMPSITIRPP-DDQHLPTANTCISRLYVP")
11764         self.assertEqual(record.rounds[2].alignments[2].hsps[0].match, "P  G N E  LN F+ IGR++GL +               K++L +KV   D    D   Y SL  ++    +   D  FS  D  F   +        ++L PNG NI VT +N  EYV      R+    E+  +A  +G  +++P+  +      +  LL+ G  E++++     T +   S  +     Q  +WFW +++  S  ++  L+ F T +  +P +     +G       TI    +   LP A+TC +RL +P")
11765         self.assertEqual(record.rounds[2].alignments[2].hsps[0].sbjct, "PHSGINPE-HLNYFKFIGRVIGLAIFHRRFVDAFFVVSFYKMILQKKVTLQDMESMDAEYYRSLVWILDNDITGVLDLTFSVEDNCFGEVVT-------IDLKPNGRNIEVTEENKREYVDLVTVWRIQKRIEEQFNAFHEGFSELIPQELINVFDERELELLIGGISEIDMEDWKKHTDYRSYSEND-----QIIKWFWELMDEWSNEKKSRLLQFTTGTSRIPVNGFKDLQGSDGPRKFTIEKAGEPNKLPKAHTCFNRLDLP")
11766         self.assertEqual(record.rounds[2].alignments[2].hsps[0].query_start, 606)
11767         self.assertEqual(record.rounds[2].alignments[2].hsps[0].query_end, 865)
11768         self.assertEqual(record.rounds[2].alignments[2].hsps[0].sbjct_start, 491)
11769         self.assertEqual(record.rounds[2].alignments[2].hsps[0].sbjct_end, 742)
11770         self.assertEqual(record.rounds[2].alignments[3].hsps[0].query, "PRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQV---ELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLP----ASEEGFQPMPSITIRP-PDDQHLPTANTCISRLYVP")
11771         self.assertEqual(record.rounds[2].alignments[3].hsps[0].match, "P  G   E  L+ F+ IGR+ G+ +   +L      R   K++L + +  HD    D   Y SLR ++    +         +DL F +D   EE  GQ    EL   G  I VT +N  EY+    + R +   ++ + A ++G  +++P++ ++     +  LL+ G G+V+V      T + +    N     Q  +WFW  V  M   +R  L+ F T +  +P    A   G     S T+      + LP A+TC +RL +P")
11772         self.assertEqual(record.rounds[2].alignments[3].hsps[0].sbjct, "PNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHDMESVDSEYYNSLRWILENDPTE--------LDLRFIID---EELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSANH----QVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLP")
11773         self.assertEqual(record.rounds[2].alignments[3].hsps[0].query_start, 606)
11774         self.assertEqual(record.rounds[2].alignments[3].hsps[0].query_end, 865)
11775         self.assertEqual(record.rounds[2].alignments[3].hsps[0].sbjct_start, 649)
11776         self.assertEqual(record.rounds[2].alignments[3].hsps[0].sbjct_end, 901)
11777         self.assertEqual(record.rounds[2].alignments[4].hsps[0].query, "PRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQV---ELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLP----ASEEGFQPMPSITIRP-PDDQHLPTANTCISRLYVP")
11778         self.assertEqual(record.rounds[2].alignments[4].hsps[0].match, "P  G   E  L+ F+ IGR+ G+ +   +L      R   K++L + +  HD    D   Y SLR ++    +         +DL F +D   EE  GQ    EL   G  I VT +N  EY+    + R +   ++ + A ++G  +++P++ ++     +  LL+ G G+V+V      T + +    N     Q   WFW  V  M   +R  L+ F T +  +P    A   G     S T+        LP A+TC +RL +P")
11779         self.assertEqual(record.rounds[2].alignments[4].hsps[0].sbjct, "PNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLQKLITLHDMESVDSEYYSSLRWILENDPTE--------LDLRFIID---EELFGQTHQHELKTGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSMNH----QVIHWFWKAVWMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPDKLPRAHTCFNRLDLP")
11780         self.assertEqual(record.rounds[2].alignments[4].hsps[0].query_start, 606)
11781         self.assertEqual(record.rounds[2].alignments[4].hsps[0].query_end, 865)
11782         self.assertEqual(record.rounds[2].alignments[4].hsps[0].sbjct_start, 679)
11783         self.assertEqual(record.rounds[2].alignments[4].hsps[0].sbjct_end, 931)
11784         self.assertEqual(record.rounds[2].alignments[5].hsps[0].query, "PRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASE----EGFQPMPSITIRPPDD-QHLPTANTCISRLYVP")
11785         self.assertEqual(record.rounds[2].alignments[5].hsps[0].match, "P  G N E  LN F+ IGR++GL +             + K++L +KV   D    D  +Y SL  ++  S     D  FSA D  F   +        V+L P+G NI VT  N  EYV  Y + R++   ++   A   G  +++P++ +      +  LL+ G  E++++     T +      +     +  +WFW  V      +R  L+ F T +  +P +     +G       TI    + Q LP ++TC +R+ +P")
11786         self.assertEqual(record.rounds[2].alignments[5].hsps[0].sbjct, "PNSGINPE-HLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKMMLRKKVVLQDMEGVDAEVYNSLNWMLENSIDGVLDLTFSADDERFGEVVT-------VDLKPDGRNIEVTDGNKKEYVELYTQWRIVDRVQEQFKAFMDGFNELIPEDLVTVFDERELELLIGGIAEIDIEDWKKHTDYRGYQESD-----EVIQWFWKCVSEWDNEQRARLLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKAGEVQQLPKSHTCFNRVDLP")
11787         self.assertEqual(record.rounds[2].alignments[5].hsps[0].query_start, 606)
11788         self.assertEqual(record.rounds[2].alignments[5].hsps[0].query_end, 865)
11789         self.assertEqual(record.rounds[2].alignments[5].hsps[0].sbjct_start, 533)
11790         self.assertEqual(record.rounds[2].alignments[5].hsps[0].sbjct_end, 784)
11791         self.assertEqual(record.rounds[2].alignments[6].hsps[0].query, "FRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQV-ELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLED-LTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVP")
11792         self.assertEqual(record.rounds[2].alignments[6].hsps[0].match, "F  IG +LGL +  N +  +     V + L+G+K  + D     PV+Y+SL+ L+    + + D     M + F +      G   + +L  NG  IP+T +N  E+V  Y+++ +    E+   A R+G   V  ++ L+     E+  LL+ G   ++ Q L   T +  + G   + +L   R FW IV   +  +++  + F T +   P    G   M  I    PD + LPT++TC + L +P")
11793         self.assertEqual(record.rounds[2].alignments[6].hsps[0].sbjct, "FTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGNVEDD-----MMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEY--DGGYTRDSVL--IREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKM-IIAKNGPDTERLPTSHTCFNVLLLP")
11794         self.assertEqual(record.rounds[2].alignments[6].hsps[0].query_start, 619)
11795         self.assertEqual(record.rounds[2].alignments[6].hsps[0].query_end, 865)
11796         self.assertEqual(record.rounds[2].alignments[6].hsps[0].sbjct_start, 612)
11797         self.assertEqual(record.rounds[2].alignments[6].hsps[0].sbjct_end, 850)
11798         self.assertEqual(record.rounds[2].alignments[7].hsps[0].query, "FRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQV-ELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLED-LTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVP")
11799         self.assertEqual(record.rounds[2].alignments[7].hsps[0].match, "F  IG + GL +  N +  +     V + L+G+K  + D     PV+Y+SL+ L+    S + D     M + F +      G   + +L  NG  IP+T +N  E+V  Y+++ +    E+   A R+G   V  ++ L+     E+  LL+ G   ++ Q L   T +  + G   E +    R FW IV   +  +++  + F T +   P    G   M  I    PD + LPT++TC + L +P")
11800         self.assertEqual(record.rounds[2].alignments[7].hsps[0].sbjct, "FTLIGIL-GLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGSVEDD-----MMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVISYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEY--DGGYTRESV--VIREFWEIVHSFTDEQKRLFLLFTTGTDRAPVGGLGKLKM-IIAKNGPDTERLPTSHTCFNVLLLP")
11801         self.assertEqual(record.rounds[2].alignments[7].hsps[0].query_start, 619)
11802         self.assertEqual(record.rounds[2].alignments[7].hsps[0].query_end, 865)
11803         self.assertEqual(record.rounds[2].alignments[7].hsps[0].sbjct_start, 623)
11804         self.assertEqual(record.rounds[2].alignments[7].hsps[0].sbjct_end, 860)
11805         self.assertEqual(record.rounds[2].alignments[8].hsps[0].query, "YTPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAV------DLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPK-NSLEDLTAEDFRLLVNGCGE---VNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYV")
11806         self.assertEqual(record.rounds[2].alignments[8].hsps[0].match, "+    GKN++  L  +   G ++GL +  + +  +   + + K L    +++ D++   P    +L +++  ++ +  D      +  +        D    +    VEL  NG N+P+T  N +E+V K+ E  +    E   +    G   V  + NS++   +E+   LV G  E    + + L S T +     +++  +     WFW I+E      ++ L+ F T+S  +PA+     P     +   D   LP A+TC + + +")
11807         self.assertEqual(record.rounds[2].alignments[8].hsps[0].sbjct, "FDKSKGKNSQLEL--YYLFGVVMGLAIFNSTILDLQFPKALYKKLCSEPLSFEDYSELFPETSRNLIKMLNYTEDNFEDVFSLTFETTYRNNNWILNDSKSSKEYVTVELCENGRNVPITQSNKHEFVMKWVEFYLEKSIEPQYNKFVSGFKRVFAECNSIKLFNSEELERLVCGDEEQTKFDFKSLRSVTKYVGGFSDDSRAVC----WFWEIIESWDYPLQKKLLQFVTASDRIPATGISTIPFKISLLGSHDSDDLPLAHTCFNEICL")
11808         self.assertEqual(record.rounds[2].alignments[8].hsps[0].query_start, 604)
11809         self.assertEqual(record.rounds[2].alignments[8].hsps[0].query_end, 864)
11810         self.assertEqual(record.rounds[2].alignments[8].hsps[0].sbjct_start, 602)
11811         self.assertEqual(record.rounds[2].alignments[8].hsps[0].sbjct_end, 866)
11812         self.assertEqual(record.rounds[2].alignments[9].hsps[0].query, "TPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNW--HDFAFFDPVMYES---LRQLILASQSSDADAVFSAMDLAFAVDL-----CKEE---------GGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRP------PDDQHLPTANTCISRLYVP")
11813         self.assertEqual(record.rounds[2].alignments[9].hsps[0].match, "T +P    + ++  FR +G+++   ++   L  + L     K +L ++ +   HD    DPV+  S   L  ++   +  + D   +   L +A++      C  E         G   +EL   G +IPVT  N+ EY+R      +     +   + R G   V P + L+    E+   L+ G                 + G   +   +  ++ + I+      +++  + F T SP LP         P   +R         D  LP+  TC++ L +P")
11814         self.assertEqual(record.rounds[2].alignments[9].hsps[0].sbjct, "TAKPAHIAKVKMK-FRFLGKLMAKAIMDFRLVDLPLGLPFYKWMLRQETSLTSHDLFDIDPVVARSVYHLEDIVRQKKRLEQDKSQTKESLQYALETLTMNGCSVEDLGLDFTLPGFPNIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVSRQFDSFRDGFESVFPLSHLQYFYPEELDQLLCGSKADTWDAKTLMECCRPDHGYTHDS--RAVKFLFEILSSFDNEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLKLP")
11815         self.assertEqual(record.rounds[2].alignments[9].hsps[0].query_start, 605)
11816         self.assertEqual(record.rounds[2].alignments[9].hsps[0].query_end, 865)
11817         self.assertEqual(record.rounds[2].alignments[9].hsps[0].sbjct_start, 1684)
11818         self.assertEqual(record.rounds[2].alignments[9].hsps[0].sbjct_end, 1966)
11819         self.assertEqual(record.rounds[2].alignments[10].hsps[0].query, "GRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQV-ELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLP----ASEEGFQPMPSITIRPPD--DQHLPTANTCISRLYVP")
11820         self.assertEqual(record.rounds[2].alignments[10].hsps[0].match, "GR +   ++   L      R   K +LG+ V + D    D   Y+ L  L+        D      DL F+ ++ +E G  +V +L PNG NI VT +N  EYV    + RM     + L A  +G  +++PK  +   T ++  LL  G   +++  L S T ++     + +      +WFW  +      +R   + F T +  +P    A+ EG   +    I   D     LP+A+TC ++L +P")
11821         self.assertEqual(record.rounds[2].alignments[10].hsps[0].sbjct, "GRYVAKAVMTTALLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLEN------DVSTLGYDLTFSTEV-QEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLYTGLPTIDIDDLKSNTEYHKYQSNSIQ-----IQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLP")
11822         self.assertEqual(record.rounds[2].alignments[10].hsps[0].query_start, 623)
11823         self.assertEqual(record.rounds[2].alignments[10].hsps[0].query_end, 865)
11824         self.assertEqual(record.rounds[2].alignments[10].hsps[0].sbjct_start, 45)
11825         self.assertEqual(record.rounds[2].alignments[10].hsps[0].sbjct_end, 282)
11826         self.assertEqual(record.rounds[2].alignments[11].hsps[0].query, "EARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGG--QVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPS-ITIRPPDDQHLPTANTCISRLYVP")
11827         self.assertEqual(record.rounds[2].alignments[11].hsps[0].match, "    N F  IG   GL +  + +  +     + K LL  K    D     P    SL++L+      D +  F    L F +  C+E  G   Q +LIP G N+ V   N  E+V  Y  +   +   +   A   G L V     LE     + R ++ G    N + L     +  +       +    + FW       + +++  + F T S  +P    G   +   I      +++LP A+TC + L +P")
11828         self.assertEqual(record.rounds[2].alignments[11].hsps[0].sbjct, "FVEHNWFHLIGITCGLAIYNSTVVDLHFPLALYKKLLNVKPGLEDLKELSPTEGRSLQELLDY-PGEDVEETFC---LNFTI--CRESYGVIEQKKLIPGGDNVTVCKDNRQEFVDAYVNYVFQISVHEWYTAFSSGFLKVCGGKVLELFQPSELRAMMVGNSNYNWEELEETAIYKGDYSATHPTV----KLFWETFHEFPLEKKKKFLLFLTGSDRIPI--YGMASLQIVIQSTASGEEYLPVAHTCYNLLDLP")
11829         self.assertEqual(record.rounds[2].alignments[11].hsps[0].query_start, 613)
11830         self.assertEqual(record.rounds[2].alignments[11].hsps[0].query_end, 865)
11831         self.assertEqual(record.rounds[2].alignments[11].hsps[0].sbjct_start, 782)
11832         self.assertEqual(record.rounds[2].alignments[11].hsps[0].sbjct_end, 1025)
11833         self.assertEqual(record.rounds[2].alignments[12].hsps[0].query, "RPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLG------------RKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASE-EGFQPMPSITIRPPD-----DQHLPTANTCISRLYVP")
11834         self.assertEqual(record.rounds[2].alignments[12].hsps[0].match, " P  N E  +  F  +G  +   LL N +     ++   ++L               +         DP++ +SL+ ++      D +    ++ L F V      G   +ELIP G N  +   NV EY+    +  +    E+ L A  +G   V     +  L  ++  + + G  E +  M   +T+ N E G   +  +     F SI+      ER+  + F T SP LP    +   P  ++ ++  +     D++LP+  TC + L +P")
11835         self.assertEqual(record.rounds[2].alignments[12].hsps[0].sbjct, "NPFSNNEKVIELFGYLGTFVARSLLDNRILDFRFSKVFFELLHRMSTPNVTTVPSDVETCLLMIELVDPLLAKSLKYIVAN---KDDNMTLESLSLTFTVP-----GNDDIELIPGGCNKSLNSSNVEEYIHGVIDQILGKGIEKQLKAFIEGFSKVFSYERMLILFPDEL-VDIFGRVEEDWSMATLYTNLNAEHGYTMDSSI--IHDFISIISAFGKHERRLFLQFLTGSPKLPIGGFKSLNPKFTVVLKHAEDGLTADEYLPSVMTCANYLKLP")
11836         self.assertEqual(record.rounds[2].alignments[12].hsps[0].query_start, 607)
11837         self.assertEqual(record.rounds[2].alignments[12].hsps[0].query_end, 865)
11838         self.assertEqual(record.rounds[2].alignments[12].hsps[0].sbjct_start, 1192)
11839         self.assertEqual(record.rounds[2].alignments[12].hsps[0].sbjct_end, 1457)
11840         self.assertEqual(record.rounds[2].alignments[13].hsps[0].query, "RLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLL----GRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCG-EVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPM-PSITIRPPDDQ--HLPTANTCISRLYVP")
11841         self.assertEqual(record.rounds[2].alignments[13].hsps[0].match, "+L     +G+++G CL ++ L  ++     +K LL    G   ++ D   +D V+Y +L +L+    ++D      ++DL F +D   E     V+LIPNG    VT  NV  YV K  ++++     +P+ A   GL  ++  + +E   + + ++L++G    +++  L S T +     E+     Q    FW ++      E+ + + F TS P  P   +GF+ + P   IR    +   LPTA+TC++ L +P")
11842         self.assertEqual(record.rounds[2].alignments[13].hsps[0].sbjct, "KLKYIWFLGKVVGKCLYEHVLIDVSFADFFLKKLLNYSNGFLSSFSDLGSYDSVLYNNLIKLLN--MTTDE---IKSLDLTFEIDE-PESSAKVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWMEMFNSIELQMLISGERDNIDLDDLKSNTEYGGYKEED-----QTIVDFWEVLNEFKFEEKLNFLKFVTSVPQAP--LQGFKALDPKFGIRNAGTEKYRLPTASTCVNLLKLP")
11843         self.assertEqual(record.rounds[2].alignments[13].hsps[0].query_start, 615)
11844         self.assertEqual(record.rounds[2].alignments[13].hsps[0].query_end, 865)
11845         self.assertEqual(record.rounds[2].alignments[13].hsps[0].sbjct_start, 640)
11846         self.assertEqual(record.rounds[2].alignments[13].hsps[0].sbjct_end, 885)
11847         self.assertEqual(record.rounds[2].alignments[14].hsps[0].query, "PDPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGA")
11848         self.assertEqual(record.rounds[2].alignments[14].hsps[0].match, "       +Q LGERLYP ++ M    A KITGM                   +A+VEEA+ ++  H     A")
11849         self.assertEqual(record.rounds[2].alignments[14].hsps[0].sbjct, "NAKPQEQKQILGERLYPMIEHMHANLAGKITGMLLEIENSELLHMIEDQEALKAKVEEAVAVLQVHRVTEPA")
11850         self.assertEqual(record.rounds[2].alignments[14].hsps[0].query_start, 478)
11851         self.assertEqual(record.rounds[2].alignments[14].hsps[0].query_end, 549)
11852         self.assertEqual(record.rounds[2].alignments[14].hsps[0].sbjct_start, 560)
11853         self.assertEqual(record.rounds[2].alignments[14].hsps[0].sbjct_end, 631)
11854         self.assertEqual(record.rounds[2].alignments[15].hsps[0].query, "DPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGA")
11855         self.assertEqual(record.rounds[2].alignments[15].hsps[0].match, " P    +Q LGERL+P +QAM P  A KITGM                   R++V+EA+ ++ AH  +  A")
11856         self.assertEqual(record.rounds[2].alignments[15].hsps[0].sbjct, "APPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAA")
11857         self.assertEqual(record.rounds[2].alignments[15].hsps[0].query_start, 479)
11858         self.assertEqual(record.rounds[2].alignments[15].hsps[0].query_end, 549)
11859         self.assertEqual(record.rounds[2].alignments[15].hsps[0].sbjct_start, 553)
11860         self.assertEqual(record.rounds[2].alignments[15].hsps[0].sbjct_end, 623)
11861         self.assertEqual(record.rounds[2].alignments[16].hsps[0].query, "DPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGA")
11862         self.assertEqual(record.rounds[2].alignments[16].hsps[0].match, " P    +Q LGERL+P +QAM P  A KITGM                   R +V+EA+ ++ AH  +  A")
11863         self.assertEqual(record.rounds[2].alignments[16].hsps[0].sbjct, "APPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRLKVDEAVAVLQAHQAKEAA")
11864         self.assertEqual(record.rounds[2].alignments[16].hsps[0].query_start, 479)
11865         self.assertEqual(record.rounds[2].alignments[16].hsps[0].query_end, 549)
11866         self.assertEqual(record.rounds[2].alignments[16].hsps[0].sbjct_start, 551)
11867         self.assertEqual(record.rounds[2].alignments[16].hsps[0].sbjct_end, 621)
11868         self.assertEqual(record.rounds[2].alignments[17].hsps[0].query, "DPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGA")
11869         self.assertEqual(record.rounds[2].alignments[17].hsps[0].match, " P    +Q LGERL+P +QAM P+ A KITGM                   R++V+EA+ ++ AH  +  A")
11870         self.assertEqual(record.rounds[2].alignments[17].hsps[0].sbjct, "APPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAA")
11871         self.assertEqual(record.rounds[2].alignments[17].hsps[0].query_start, 479)
11872         self.assertEqual(record.rounds[2].alignments[17].hsps[0].query_end, 549)
11873         self.assertEqual(record.rounds[2].alignments[17].hsps[0].sbjct_start, 553)
11874         self.assertEqual(record.rounds[2].alignments[17].hsps[0].sbjct_end, 623)
11875         self.assertEqual(record.rounds[2].alignments[18].hsps[0].query, "PDPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELI")
11876         self.assertEqual(record.rounds[2].alignments[18].hsps[0].match, "       R  LGE LYP V+ ++   A+K+TGM                   +A+V EAM+++")
11877         self.assertEqual(record.rounds[2].alignments[18].hsps[0].sbjct, "NATPEQQRTMLGEVLYPLVEQVEAESAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVL")
11878         self.assertEqual(record.rounds[2].alignments[18].hsps[0].query_start, 478)
11879         self.assertEqual(record.rounds[2].alignments[18].hsps[0].query_end, 540)
11880         self.assertEqual(record.rounds[2].alignments[18].hsps[0].sbjct_start, 549)
11881         self.assertEqual(record.rounds[2].alignments[18].hsps[0].sbjct_end, 611)
11882         self.assertEqual(record.rounds[2].alignments[19].hsps[0].query, "PASEGNPSDDPD------PLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIV")
11883         self.assertEqual(record.rounds[2].alignments[19].hsps[0].match, "PA  G P           P  + +Q LGE LYP+V   +   + KITGM                     RV EA+ ++ ")
11884         self.assertEqual(record.rounds[2].alignments[19].hsps[0].sbjct, "PAVPGMPERFTAADLAAVPEESRKQVLGELLYPKVFVREEKLSGKITGMLLEMPNSELLELLEDDSALNERVNEAIGVLQ")
11885         self.assertEqual(record.rounds[2].alignments[19].hsps[0].query_start, 468)
11886         self.assertEqual(record.rounds[2].alignments[19].hsps[0].query_end, 541)
11887         self.assertEqual(record.rounds[2].alignments[19].hsps[0].sbjct_start, 563)
11888         self.assertEqual(record.rounds[2].alignments[19].hsps[0].sbjct_end, 642)
11889         self.assertEqual(record.rounds[2].alignments[20].hsps[0].query, "DPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELI")
11890         self.assertEqual(record.rounds[2].alignments[20].hsps[0].match, "     H + LG+ LYP V+  +PA  +K+TGM                   +A+V EA++++")
11891         self.assertEqual(record.rounds[2].alignments[20].hsps[0].sbjct, "ASPDKHPRMLGDHLYPLVEQQEPANPAKVTGMLLEMDQAEILHLLESPEALKAKVSEALDVL")
11892         self.assertEqual(record.rounds[2].alignments[20].hsps[0].query_start, 479)
11893         self.assertEqual(record.rounds[2].alignments[20].hsps[0].query_end, 540)
11894         self.assertEqual(record.rounds[2].alignments[20].hsps[0].sbjct_start, 585)
11895         self.assertEqual(record.rounds[2].alignments[20].hsps[0].sbjct_end, 646)
11896         self.assertEqual(record.rounds[2].alignments[21].hsps[0].query, "PASEGNPSDDPDP----LPAHRQALGERLYPRVQA--MQPAFASKITGM")
11897         self.assertEqual(record.rounds[2].alignments[21].hsps[0].match, "P   G P +  D         RQALGE+LY +V A       A KITGM")
11898         self.assertEqual(record.rounds[2].alignments[21].hsps[0].sbjct, "PPQGGFPRNANDNNQFYQQKQRQALGEQLYKKVSAKTSNEEAAGKITGM")
11899         self.assertEqual(record.rounds[2].alignments[21].hsps[0].query_start, 468)
11900         self.assertEqual(record.rounds[2].alignments[21].hsps[0].query_end, 510)
11901         self.assertEqual(record.rounds[2].alignments[21].hsps[0].sbjct_start, 484)
11902         self.assertEqual(record.rounds[2].alignments[21].hsps[0].sbjct_end, 532)
11903         self.assertEqual(record.rounds[2].alignments[22].hsps[0].query, "LAEEADSSKPGPSAHDVAAQLKSSLLAEIGLTESEGPPLTSFRPQCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKE")
11904         self.assertEqual(record.rounds[2].alignments[22].hsps[0].match, "+A +  S+  GP +      ++ S  A++   E+  P  T  RP  +  G V S      +W    E   R F         S  + L  F+  E")
11905         self.assertEqual(record.rounds[2].alignments[22].hsps[0].sbjct, "VASQYSSTPSGPVSVSAMRAVQRSFSAQLAHNEARQPEPTYLRPVSTSYGPVPSTQSAQEQWYSPTEAQFRAFTAAHSMPTTSAQSPLTTFDTPE")
11906         self.assertEqual(record.rounds[2].alignments[22].hsps[0].query_start, 219)
11907         self.assertEqual(record.rounds[2].alignments[22].hsps[0].query_end, 313)
11908         self.assertEqual(record.rounds[2].alignments[22].hsps[0].sbjct_start, 702)
11909         self.assertEqual(record.rounds[2].alignments[22].hsps[0].sbjct_end, 796)
11910         self.assertEqual(record.rounds[2].alignments[23].hsps[0].query, "SAMDLAFAVDLCKEEGGGQ---VELIPNGVNIPVTPQNVYEYVRKY-AEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCG")
11911         self.assertEqual(record.rounds[2].alignments[23].hsps[0].match, "    L F +D  K         +EL P G            YV      + +    E    A ++G     P  +L  L  E     +    ")
11912         self.assertEqual(record.rounds[2].alignments[23].hsps[0].sbjct, "LREQLCFTIDPEKAGDFDDAVAIELTPEGY--------YKLYVHIADVSYYVREGTETDKEAYKRGFTYYFPDRALHML-PEKLSAKLCSLR")
11913         self.assertEqual(record.rounds[2].alignments[23].hsps[0].query_start, 686)
11914         self.assertEqual(record.rounds[2].alignments[23].hsps[0].query_end, 773)
11915         self.assertEqual(record.rounds[2].alignments[23].hsps[0].sbjct_start, 243)
11916         self.assertEqual(record.rounds[2].alignments[23].hsps[0].sbjct_end, 325)
11917         self.assertEqual(record.rounds[3].alignments[0].hsps[0].query, "MMSARGDFLNYALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQALIYWIKAMNQQTTLDTPQXXXXXXXXXXXXGIXXXXXXXXXXXXTSQSATLNDKDDESLPAETGQNHPFFRRSDSMTFLGCIPPNPFEVPLAEAIPLADQPHLLQPNARKEDLFGRPSQGLYSSSAGSGKCLVEVTMDRNCLEVLPTKMSYAANLKNVMNMQNRQKKAGEDQSMLAEEADSSKPGPSAHDVAAQLKSSLLAEIGLTESEGPPLTSFRPQCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKESKFRREMEKLRNQQSRDLSLEVDRDRDLLIQQTMRQLNNHFGRRCATTPMAVHRVKVTFKDEPGEGSGVARSFYTAIAQAFLSNEKLPNLDCIQNANKGTHTSLMQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSIDTRPFRPASEGNPSDDPDPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGAXXXXXXXXXXXXEKVQENRKRHGSSRSVVXXXXXXXXXXXXNAPLFYQPGKRGFYTPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVPXXXXXXXXXXXXXXXXXXXNFGFV")
11918         self.assertEqual(record.rounds[3].alignments[0].hsps[0].match, "MMSARGDFLNYALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQALIYWIKAMNQQTTLDTPQ            GI            TSQSATLNDKDDESLPAETGQNHPFFRRSDSMTFLGCIPPNPFEVPLAEAIPLADQPHLLQPNARKEDLFGRPSQGLYSSSAGSGKCLVEVTMDRNCLEVLPTKMSYAANLKNVMNMQNRQKKAGEDQSMLAEEADSSKPGPSAHDVAAQLKSSLLAEIGLTESEGPPLTSFRPQCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKESKFRREMEKLRNQQSRDLSLEVDRDRDLLIQQTMRQLNNHFGRRCATTPMAVHRVKVTFKDEPGEGSGVARSFYTAIAQAFLSNEKLPNLDCIQNANKGTHTSLMQ                                      QLSIDTRPFRPASEGNPSDDPDPLPAHRQALGERLYPRVQAMQPAFASKITGM                   RARVEEAMELIVAHGRENGA            EKVQENRKRHGSSRSVV            NAPLFYQPGKRGFYTPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVP                   NFGFV")
11919         self.assertEqual(record.rounds[3].alignments[0].hsps[0].sbjct, "MMSARGDFLNYALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQALIYWIKAMNQQTTLDTPQLERKRTRELLELGIDNEDSEHENDDDTSQSATLNDKDDESLPAETGQNHPFFRRSDSMTFLGCIPPNPFEVPLAEAIPLADQPHLLQPNARKEDLFGRPSQGLYSSSAGSGKCLVEVTMDRNCLEVLPTKMSYAANLKNVMNMQNRQKKAGEDQSMLAEEADSSKPGPSAHDVAAQLKSSLLAEIGLTESEGPPLTSFRPQCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKESKFRREMEKLRNQQSRDLSLEVDRDRDLLIQQTMRQLNNHFGRRCATTPMAVHRVKVTFKDEPGEGSGVARSFYTAIAQAFLSNEKLPNLDCIQNANKGTHTSLMQRLRNRGERDREREREREMRRSSGLRAGSRRDRDRDFRRQLSIDTRPFRPASEGNPSDDPDPLPAHRQALGERLYPRVQAMQPAFASKITGMLLELSPAQLLLLLASEDSLRARVEEAMELIVAHGRENGADSILDLGLLDSSEKVQENRKRHGSSRSVVDMDLDDTDDGDDNAPLFYQPGKRGFYTPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVPLYSSKQILKQKLLLAIKTKNFGFV")
11920         self.assertEqual(record.rounds[3].alignments[0].hsps[0].query_start, 1)
11921         self.assertEqual(record.rounds[3].alignments[0].hsps[0].query_end, 889)
11922         self.assertEqual(record.rounds[3].alignments[0].hsps[0].sbjct_start, 1)
11923         self.assertEqual(record.rounds[3].alignments[0].hsps[0].sbjct_end, 889)
11924         self.assertEqual(record.rounds[3].alignments[1].hsps[0].query, "QCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKESKFRREMEKLRNQQSRDLSL-EVDRDRDLLIQQTMRQLNNHFGR--RCATTPMAVHRVKVTFKDEPGEGSGVARSFYTAIAQAFLSNEKLPNLDCIQNANKGTHTSLMQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSIDTRPFRPASEGN---PSDDPDPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGAXXXXXXXXXXXXEKVQENRKRHGSSRSVVXXXXXXXXXXXXNAPLFYQPGKRGFYTPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRM-LVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLL-QFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVPXXXXXXXXXXXXXXXXXXXNFGFV")
11925         self.assertEqual(record.rounds[3].alignments[1].hsps[0].match, "Q +F G+   + +L  +  L+L+LFGR FM+DVG E GS+L EL GF VKE +FRR MEKLRN Q RDL L +++R+R+ LI QT ++LN  FG   R    P+  +RVKVTFKDEPGEGSGVARSFYT+IA+A L++ K+PNL+ +Q      H+  +                                        L++D RP+ P +  +   P    D L  H Q +GERLYP++ ++    A KITGM                   R +V EA+E+I    +   +               Q ++ +   S  VV            N PLFY PGKRGFY PR G  +  R+N FRNIGR++GLCLLQNEL P+ L RHV+K +L RK+ +HD AFFDP +YES RQ+I  +Q+ + +   + M+L F +DL KEEG G  ELIP G ++ V+ + +Y       ++   +   E+ L A++ G+ DVLP NS+ +LTAED RLL+NG G++NV  LIS+T+FNDES E  +K L +FK+WFWSIVE+M++ ERQ LVYFWT SP+LPASEEGFQP+PS+TIRP DD HLPTANTCISRLY+P                   NFGFV")
11926         self.assertEqual(record.rounds[3].alignments[1].hsps[0].sbjct, "QSNFSGIAPCNFLLSAK--LTLDLFGRPFMDDVGMEHGSVLPELRGFPVKEMRFRRHMEKLRNGQQRDLVLCKLERNRESLIVQTFKELNTQFGNQSRRIQPPITFNRVKVTFKDEPGEGSGVARSFYTSIAEALLASAKIPNLESVQVGTN--HSKYVVPFSSILRTTVSGSSRDQSTLQRRGSNSKILWRSARERKALNLDARPYTPPNSSDNATPESLNDHLSVHLQQIGERLYPKIHSINQTHAPKITGMLLEIPTPQLLSVISSDETLRQKVNEAIEIITFKQKSETSA--------------QSSQPKKSPSVVVVDPVDDD------NEPLFYSPGKRGFYIPRQGFASFERINAFRNIGRLIGLCLLQNELLPLFLQRHVLKYILRRKIKFHDLAFFDPALYESFRQIIQNAQTKEGEETINRMELCFVIDLMKEEGCGNRELIPGGRDV-VSHRVIYSSTSDAIQNIDXIKSQEKALEALKDGVFDVLPDNSMINLTAEDLRLLLNGVGDINVSTLISYTTFNDESSEGPDK-LXKFKKWFWSIVEKMNIMERQHLVYFWTGSPALPASEEGFQPLPSVTIRPADDSHLPTANTCISRLYIPLYSSKSILRSKMLMAIKSKNFGFV")
11927         self.assertEqual(record.rounds[3].alignments[1].hsps[0].query_start, 263)
11928         self.assertEqual(record.rounds[3].alignments[1].hsps[0].query_end, 889)
11929         self.assertEqual(record.rounds[3].alignments[1].hsps[0].sbjct_start, 2287)
11930         self.assertEqual(record.rounds[3].alignments[1].hsps[0].sbjct_end, 2895)
11931         self.assertEqual(record.rounds[3].alignments[1].hsps[1].query, "SARGDFLNYALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQALIYWIKAMNQQTTLDTPQXXXXXXXXXXXXGIXXXXXXXXXXXXTSQSATLNDKDDE------SLPA--ETGQNHPFFRRSDSMTFLGCIPPNPFEVPLAEAIPLADQPHLLQPNARKEDLFGRPSQGLYSSSAGSGKCLVEVTMD---RNCLEVLPTKMSYAANLK")
11932         self.assertEqual(record.rounds[3].alignments[1].hsps[1].match, "++R DF  Y LSLMRSH  EH D LPVLD+ +L+H+AYV  A +Y+++  N     D                I              + A L + + +      S+P+  +  + H FF RS+S   LGC  P  FE+PL  A+PLAD+PHLLQPN+++++LF      + +++  SG      T D    +  +  PT++ ++ +LK")
11933         self.assertEqual(record.rounds[3].alignments[1].hsps[1].sbjct, "NSRRDFFTYCLSLMRSHTSEHRDALPVLDITALRHIAYVLDAFVYYMR--NDSGFYDKQDSISGR--------INNLSPMTESYDTDDELANLEEFNADVQMSASSMPSGSQGTRRHAFFARSESTLTLGCSAPEGFELPLDMAMPLADKPHLLQPNSKRQELFANLPLLVTTNANNSG-----ATNDGDGASIFDYTPTRLGFSNSLK")
11934         self.assertEqual(record.rounds[3].alignments[1].hsps[1].query_start, 3)
11935         self.assertEqual(record.rounds[3].alignments[1].hsps[1].query_end, 200)
11936         self.assertEqual(record.rounds[3].alignments[1].hsps[1].sbjct_start, 1913)
11937         self.assertEqual(record.rounds[3].alignments[1].hsps[1].sbjct_end, 2106)
11938         self.assertEqual(record.rounds[3].alignments[2].hsps[0].query, "PRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASE----EGFQPMPSITIRPP-DDQHLPTANTCISRLYVP")
11939         self.assertEqual(record.rounds[3].alignments[2].hsps[0].match, "P  G N E  LN F+ IGR++GL +               K++L +KV   D    D   Y SL  ++    +   D  FS  D  F   +        ++L PNG NI VT +N  EYV      R+    E+  +A  +G  +++P+  +      +  LL+ G  E++++     T +   S  +     Q  +WFW +++  S  ++  L+ F T +  +P +     +G       TI    +   LP A+TC +RL +P")
11940         self.assertEqual(record.rounds[3].alignments[2].hsps[0].sbjct, "PHSGINPE-HLNYFKFIGRVIGLAIFHRRFVDAFFVVSFYKMILQKKVTLQDMESMDAEYYRSLVWILDNDITGVLDLTFSVEDNCFGEVVT-------IDLKPNGRNIEVTEENKREYVDLVTVWRIQKRIEEQFNAFHEGFSELIPQELINVFDERELELLIGGISEIDMEDWKKHTDYRSYSEND-----QIIKWFWELMDEWSNEKKSRLLQFTTGTSRIPVNGFKDLQGSDGPRKFTIEKAGEPNKLPKAHTCFNRLDLP")
11941         self.assertEqual(record.rounds[3].alignments[2].hsps[0].query_start, 606)
11942         self.assertEqual(record.rounds[3].alignments[2].hsps[0].query_end, 865)
11943         self.assertEqual(record.rounds[3].alignments[2].hsps[0].sbjct_start, 491)
11944         self.assertEqual(record.rounds[3].alignments[2].hsps[0].sbjct_end, 742)
11945         self.assertEqual(record.rounds[3].alignments[3].hsps[0].query, "PRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQV---ELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASE----EGFQPMPSITIRP-PDDQHLPTANTCISRLYVP")
11946         self.assertEqual(record.rounds[3].alignments[3].hsps[0].match, "P  G   E  L+ F+ IGR+ G+ +   +L      R   K++L + +  HD    D   Y SLR ++    +         +DL F +D   EE  GQ    EL   G  I VT +N  EY+    + R +   ++ + A ++G  +++P++ ++     +  LL+ G G+V+V      T + +    N     Q  +WFW  V  M   +R  L+ F T +  +P +      G     S T+      + LP A+TC +RL +P")
11947         self.assertEqual(record.rounds[3].alignments[3].hsps[0].sbjct, "PNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHDMESVDSEYYNSLRWILENDPTE--------LDLRFIID---EELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSANH----QVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLP")
11948         self.assertEqual(record.rounds[3].alignments[3].hsps[0].query_start, 606)
11949         self.assertEqual(record.rounds[3].alignments[3].hsps[0].query_end, 865)
11950         self.assertEqual(record.rounds[3].alignments[3].hsps[0].sbjct_start, 649)
11951         self.assertEqual(record.rounds[3].alignments[3].hsps[0].sbjct_end, 901)
11952         self.assertEqual(record.rounds[3].alignments[4].hsps[0].query, "PRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQV---ELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASE----EGFQPMPSITIRP-PDDQHLPTANTCISRLYVP")
11953         self.assertEqual(record.rounds[3].alignments[4].hsps[0].match, "P  G   E  L+ F+ IGR+ G+ +   +L      R   K++L + +  HD    D   Y SLR ++    +         +DL F +D   EE  GQ    EL   G  I VT +N  EY+    + R +   ++ + A ++G  +++P++ ++     +  LL+ G G+V+V      T + +    N     Q   WFW  V  M   +R  L+ F T +  +P +      G     S T+        LP A+TC +RL +P")
11954         self.assertEqual(record.rounds[3].alignments[4].hsps[0].sbjct, "PNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLQKLITLHDMESVDSEYYSSLRWILENDPTE--------LDLRFIID---EELFGQTHQHELKTGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSMNH----QVIHWFWKAVWMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPDKLPRAHTCFNRLDLP")
11955         self.assertEqual(record.rounds[3].alignments[4].hsps[0].query_start, 606)
11956         self.assertEqual(record.rounds[3].alignments[4].hsps[0].query_end, 865)
11957         self.assertEqual(record.rounds[3].alignments[4].hsps[0].sbjct_start, 679)
11958         self.assertEqual(record.rounds[3].alignments[4].hsps[0].sbjct_end, 931)
11959         self.assertEqual(record.rounds[3].alignments[5].hsps[0].query, "PRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASE----EGFQPMPSITIRPPDD-QHLPTANTCISRLYVP")
11960         self.assertEqual(record.rounds[3].alignments[5].hsps[0].match, "P  G N E  LN F+ IGR++GL +             + K++L +KV   D    D  +Y SL  ++  S     D  FSA D  F   +        V+L P+G NI VT  N  EYV  Y + R++   ++   A   G  +++P++ +      +  LL+ G  E++++     T +      +     +  +WFW  V      +R  L+ F T +  +P +     +G       TI    + Q LP ++TC +R+ +P")
11961         self.assertEqual(record.rounds[3].alignments[5].hsps[0].sbjct, "PNSGINPE-HLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKMMLRKKVVLQDMEGVDAEVYNSLNWMLENSIDGVLDLTFSADDERFGEVVT-------VDLKPDGRNIEVTDGNKKEYVELYTQWRIVDRVQEQFKAFMDGFNELIPEDLVTVFDERELELLIGGIAEIDIEDWKKHTDYRGYQESD-----EVIQWFWKCVSEWDNEQRARLLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKAGEVQQLPKSHTCFNRVDLP")
11962         self.assertEqual(record.rounds[3].alignments[5].hsps[0].query_start, 606)
11963         self.assertEqual(record.rounds[3].alignments[5].hsps[0].query_end, 865)
11964         self.assertEqual(record.rounds[3].alignments[5].hsps[0].sbjct_start, 533)
11965         self.assertEqual(record.rounds[3].alignments[5].hsps[0].sbjct_end, 784)
11966         self.assertEqual(record.rounds[3].alignments[6].hsps[0].query, "FRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQV-ELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLED-LTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVP")
11967         self.assertEqual(record.rounds[3].alignments[6].hsps[0].match, "F  IG +LGL +  N +  +     V + L+G+K  + D     PV+Y+SL+ L+    + + D     M + F +      G   + +L  NG  IP+T +N  E+V  Y+++ +    E+   A R+G   V  ++ L+     E+  LL+ G   ++ Q L   T +  + G   + +L   R FW IV   +  +++  + F T +   P    G   M  I    PD + LPT++TC + L +P")
11968         self.assertEqual(record.rounds[3].alignments[6].hsps[0].sbjct, "FTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGNVEDD-----MMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEY--DGGYTRDSVL--IREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKM-IIAKNGPDTERLPTSHTCFNVLLLP")
11969         self.assertEqual(record.rounds[3].alignments[6].hsps[0].query_start, 619)
11970         self.assertEqual(record.rounds[3].alignments[6].hsps[0].query_end, 865)
11971         self.assertEqual(record.rounds[3].alignments[6].hsps[0].sbjct_start, 612)
11972         self.assertEqual(record.rounds[3].alignments[6].hsps[0].sbjct_end, 850)
11973         self.assertEqual(record.rounds[3].alignments[7].hsps[0].query, "FRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQV-ELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLED-LTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVP")
11974         self.assertEqual(record.rounds[3].alignments[7].hsps[0].match, "F  IG + GL +  N +  +     V + L+G+K  + D     PV+Y+SL+ L+    S + D     M + F +      G   + +L  NG  IP+T +N  E+V  Y+++ +    E+   A R+G   V  ++ L+     E+  LL+ G   ++ Q L   T +  + G   E +    R FW IV   +  +++  + F T +   P    G   M  I    PD + LPT++TC + L +P")
11975         self.assertEqual(record.rounds[3].alignments[7].hsps[0].sbjct, "FTLIGIL-GLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGSVEDD-----MMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVISYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEY--DGGYTRESV--VIREFWEIVHSFTDEQKRLFLLFTTGTDRAPVGGLGKLKM-IIAKNGPDTERLPTSHTCFNVLLLP")
11976         self.assertEqual(record.rounds[3].alignments[7].hsps[0].query_start, 619)
11977         self.assertEqual(record.rounds[3].alignments[7].hsps[0].query_end, 865)
11978         self.assertEqual(record.rounds[3].alignments[7].hsps[0].sbjct_start, 623)
11979         self.assertEqual(record.rounds[3].alignments[7].hsps[0].sbjct_end, 860)
11980         self.assertEqual(record.rounds[3].alignments[8].hsps[0].query, "YTPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAV------DLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPK-NSLEDLTAEDFRLLVNGCGE---VNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYV")
11981         self.assertEqual(record.rounds[3].alignments[8].hsps[0].match, "+    GKN++  L  +   G ++GL +  + +  +   + + K L    +++ D++   P    +L +++  ++ +  D      +  +        D    +    VEL  NG N+P+T  N +E+V K+ E  +    E   +    G   V  + NS++   +E+   LV G  E    + + L S T +     +++  +     WFW I+E      ++ L+ F T+S  +PA+     P     +   D   LP A+TC + + +")
11982         self.assertEqual(record.rounds[3].alignments[8].hsps[0].sbjct, "FDKSKGKNSQLEL--YYLFGVVMGLAIFNSTILDLQFPKALYKKLCSEPLSFEDYSELFPETSRNLIKMLNYTEDNFEDVFSLTFETTYRNNNWILNDSKSSKEYVTVELCENGRNVPITQSNKHEFVMKWVEFYLEKSIEPQYNKFVSGFKRVFAECNSIKLFNSEELERLVCGDEEQTKFDFKSLRSVTKYVGGFSDDSRAVC----WFWEIIESWDYPLQKKLLQFVTASDRIPATGISTIPFKISLLGSHDSDDLPLAHTCFNEICL")
11983         self.assertEqual(record.rounds[3].alignments[8].hsps[0].query_start, 604)
11984         self.assertEqual(record.rounds[3].alignments[8].hsps[0].query_end, 864)
11985         self.assertEqual(record.rounds[3].alignments[8].hsps[0].sbjct_start, 602)
11986         self.assertEqual(record.rounds[3].alignments[8].hsps[0].sbjct_end, 866)
11987         self.assertEqual(record.rounds[3].alignments[9].hsps[0].query, "TPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNW--HDFAFFDPVMYES---LRQLILASQSSDADAVFSAMDLAFAVDL-----CKEE---------GGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRP------PDDQHLPTANTCISRLYVP")
11988         self.assertEqual(record.rounds[3].alignments[9].hsps[0].match, "T +P    + ++  FR +G+++   ++   L  + L     K +L ++ +   HD    DPV+  S   L  ++   +  + D   +   L +A++      C  E         G   +EL   G +IPVT  N+ EY+R      +     +   + R G   V P + L+    E+   L+ G                 + G   +   +  ++ + I+      +++  + F T SP LP         P   +R         D  LP+  TC++ L +P")
11989         self.assertEqual(record.rounds[3].alignments[9].hsps[0].sbjct, "TAKPAHIAKVKMK-FRFLGKLMAKAIMDFRLVDLPLGLPFYKWMLRQETSLTSHDLFDIDPVVARSVYHLEDIVRQKKRLEQDKSQTKESLQYALETLTMNGCSVEDLGLDFTLPGFPNIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVSRQFDSFRDGFESVFPLSHLQYFYPEELDQLLCGSKADTWDAKTLMECCRPDHGYTHDS--RAVKFLFEILSSFDNEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLKLP")
11990         self.assertEqual(record.rounds[3].alignments[9].hsps[0].query_start, 605)
11991         self.assertEqual(record.rounds[3].alignments[9].hsps[0].query_end, 865)
11992         self.assertEqual(record.rounds[3].alignments[9].hsps[0].sbjct_start, 1684)
11993         self.assertEqual(record.rounds[3].alignments[9].hsps[0].sbjct_end, 1966)
11994         self.assertEqual(record.rounds[3].alignments[10].hsps[0].query, "GRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQV-ELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLP----ASEEGFQPMPSITIRPPD--DQHLPTANTCISRLYVP")
11995         self.assertEqual(record.rounds[3].alignments[10].hsps[0].match, "GR +   ++   L      R   K +LG+ V + D    D   Y+ L  L+        D      DL F+ ++ +E G  +V +L PNG NI VT +N  EYV    + RM     + L A  +G  +++PK  +   T ++  LL  G   +++  L S T ++     + +      +WFW  +      +R   + F T +  +P    A+ EG   +    I   D     LP+A+TC ++L +P")
11996         self.assertEqual(record.rounds[3].alignments[10].hsps[0].sbjct, "GRYVAKAVMTTALLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLEN------DVSTLGYDLTFSTEV-QEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLYTGLPTIDIDDLKSNTEYHKYQSNSIQ-----IQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLP")
11997         self.assertEqual(record.rounds[3].alignments[10].hsps[0].query_start, 623)
11998         self.assertEqual(record.rounds[3].alignments[10].hsps[0].query_end, 865)
11999         self.assertEqual(record.rounds[3].alignments[10].hsps[0].sbjct_start, 45)
12000         self.assertEqual(record.rounds[3].alignments[10].hsps[0].sbjct_end, 282)
12001         self.assertEqual(record.rounds[3].alignments[11].hsps[0].query, "EARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGG--QVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPS-ITIRPPDDQHLPTANTCISRLYVP")
12002         self.assertEqual(record.rounds[3].alignments[11].hsps[0].match, "    N F  IG   GL +  + +  +     + K LL  K    D     P    SL++L+      D +  F    L F +  C+E  G   Q +LIP G N+ V   N  E+V  Y  +   +   +   A   G L V     LE     + R ++ G    N + L     +  +       +    + FW       + +++  + F T S  +P    G   +   I      +++LP A+TC + L +P")
12003         self.assertEqual(record.rounds[3].alignments[11].hsps[0].sbjct, "FVEHNWFHLIGITCGLAIYNSTVVDLHFPLALYKKLLNVKPGLEDLKELSPTEGRSLQELLDY-PGEDVEETFC---LNFTI--CRESYGVIEQKKLIPGGDNVTVCKDNRQEFVDAYVNYVFQISVHEWYTAFSSGFLKVCGGKVLELFQPSELRAMMVGNSNYNWEELEETAIYKGDYSATHPTV----KLFWETFHEFPLEKKKKFLLFLTGSDRIPI--YGMASLQIVIQSTASGEEYLPVAHTCYNLLDLP")
12004         self.assertEqual(record.rounds[3].alignments[11].hsps[0].query_start, 613)
12005         self.assertEqual(record.rounds[3].alignments[11].hsps[0].query_end, 865)
12006         self.assertEqual(record.rounds[3].alignments[11].hsps[0].sbjct_start, 782)
12007         self.assertEqual(record.rounds[3].alignments[11].hsps[0].sbjct_end, 1025)
12008         self.assertEqual(record.rounds[3].alignments[12].hsps[0].query, "RPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLG------------RKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASE-EGFQPMPSITIRPPD-----DQHLPTANTCISRLYVP")
12009         self.assertEqual(record.rounds[3].alignments[12].hsps[0].match, " P  N E  +  F  +G  +   LL N +     ++   ++L               +         DP++ +SL+ ++      D +    ++ L F V      G   +ELIP G N  +   NV EY+    +  +    E+ L A  +G   V     +  L  ++  + + G  E +  M   +T+ N E G   +  +     F SI+      ER+  + F T SP LP    +   P  ++ ++  +     D++LP+  TC + L +P")
12010         self.assertEqual(record.rounds[3].alignments[12].hsps[0].sbjct, "NPFSNNEKVIELFGYLGTFVARSLLDNRILDFRFSKVFFELLHRMSTPNVTTVPSDVETCLLMIELVDPLLAKSLKYIVAN---KDDNMTLESLSLTFTVP-----GNDDIELIPGGCNKSLNSSNVEEYIHGVIDQILGKGIEKQLKAFIEGFSKVFSYERMLILFPDEL-VDIFGRVEEDWSMATLYTNLNAEHGYTMDSSI--IHDFISIISAFGKHERRLFLQFLTGSPKLPIGGFKSLNPKFTVVLKHAEDGLTADEYLPSVMTCANYLKLP")
12011         self.assertEqual(record.rounds[3].alignments[12].hsps[0].query_start, 607)
12012         self.assertEqual(record.rounds[3].alignments[12].hsps[0].query_end, 865)
12013         self.assertEqual(record.rounds[3].alignments[12].hsps[0].sbjct_start, 1192)
12014         self.assertEqual(record.rounds[3].alignments[12].hsps[0].sbjct_end, 1457)
12015         self.assertEqual(record.rounds[3].alignments[13].hsps[0].query, "RLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLL----GRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCG-EVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPM-PSITIRPPDDQ--HLPTANTCISRLYVP")
12016         self.assertEqual(record.rounds[3].alignments[13].hsps[0].match, "+L     +G+++G CL ++ L  ++     +K LL    G   ++ D   +D V+Y +L +L+    ++D      ++DL F +D   E     V+LIPNG    VT  NV  YV K  ++++     +P+ A   GL  ++  + +E   + + ++L++G    +++  L S T +     E+     Q    FW ++      E+ + + F TS P  P   +GF+ + P   IR    +   LPTA+TC++ L +P")
12017         self.assertEqual(record.rounds[3].alignments[13].hsps[0].sbjct, "KLKYIWFLGKVVGKCLYEHVLIDVSFADFFLKKLLNYSNGFLSSFSDLGSYDSVLYNNLIKLLN--MTTDE---IKSLDLTFEIDE-PESSAKVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWMEMFNSIELQMLISGERDNIDLDDLKSNTEYGGYKEED-----QTIVDFWEVLNEFKFEEKLNFLKFVTSVPQAP--LQGFKALDPKFGIRNAGTEKYRLPTASTCVNLLKLP")
12018         self.assertEqual(record.rounds[3].alignments[13].hsps[0].query_start, 615)
12019         self.assertEqual(record.rounds[3].alignments[13].hsps[0].query_end, 865)
12020         self.assertEqual(record.rounds[3].alignments[13].hsps[0].sbjct_start, 640)
12021         self.assertEqual(record.rounds[3].alignments[13].hsps[0].sbjct_end, 885)
12022         self.assertEqual(record.rounds[3].alignments[14].hsps[0].query, "DPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGA")
12023         self.assertEqual(record.rounds[3].alignments[14].hsps[0].match, " P    +Q LGERL+P +QAM P  A KITGM                   R++V+EA+ ++ AH  +  A")
12024         self.assertEqual(record.rounds[3].alignments[14].hsps[0].sbjct, "APPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAA")
12025         self.assertEqual(record.rounds[3].alignments[14].hsps[0].query_start, 479)
12026         self.assertEqual(record.rounds[3].alignments[14].hsps[0].query_end, 549)
12027         self.assertEqual(record.rounds[3].alignments[14].hsps[0].sbjct_start, 553)
12028         self.assertEqual(record.rounds[3].alignments[14].hsps[0].sbjct_end, 623)
12029         self.assertEqual(record.rounds[3].alignments[15].hsps[0].query, "PDPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGA")
12030         self.assertEqual(record.rounds[3].alignments[15].hsps[0].match, "       +Q LGERLYP ++ M    A KITGM                   +A+VEEA+ ++  H     A")
12031         self.assertEqual(record.rounds[3].alignments[15].hsps[0].sbjct, "NAKPQEQKQILGERLYPMIEHMHANLAGKITGMLLEIENSELLHMIEDQEALKAKVEEAVAVLQVHRVTEPA")
12032         self.assertEqual(record.rounds[3].alignments[15].hsps[0].query_start, 478)
12033         self.assertEqual(record.rounds[3].alignments[15].hsps[0].query_end, 549)
12034         self.assertEqual(record.rounds[3].alignments[15].hsps[0].sbjct_start, 560)
12035         self.assertEqual(record.rounds[3].alignments[15].hsps[0].sbjct_end, 631)
12036         self.assertEqual(record.rounds[3].alignments[16].hsps[0].query, "DPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGA")
12037         self.assertEqual(record.rounds[3].alignments[16].hsps[0].match, " P    +Q LGERL+P +QAM P  A KITGM                   R +V+EA+ ++ AH  +  A")
12038         self.assertEqual(record.rounds[3].alignments[16].hsps[0].sbjct, "APPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRLKVDEAVAVLQAHQAKEAA")
12039         self.assertEqual(record.rounds[3].alignments[16].hsps[0].query_start, 479)
12040         self.assertEqual(record.rounds[3].alignments[16].hsps[0].query_end, 549)
12041         self.assertEqual(record.rounds[3].alignments[16].hsps[0].sbjct_start, 551)
12042         self.assertEqual(record.rounds[3].alignments[16].hsps[0].sbjct_end, 621)
12043         self.assertEqual(record.rounds[3].alignments[17].hsps[0].query, "DPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGA")
12044         self.assertEqual(record.rounds[3].alignments[17].hsps[0].match, " P    +Q LGERL+P +QAM P+ A KITGM                   R++V+EA+ ++ AH  +  A")
12045         self.assertEqual(record.rounds[3].alignments[17].hsps[0].sbjct, "APPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAA")
12046         self.assertEqual(record.rounds[3].alignments[17].hsps[0].query_start, 479)
12047         self.assertEqual(record.rounds[3].alignments[17].hsps[0].query_end, 549)
12048         self.assertEqual(record.rounds[3].alignments[17].hsps[0].sbjct_start, 553)
12049         self.assertEqual(record.rounds[3].alignments[17].hsps[0].sbjct_end, 623)
12050         self.assertEqual(record.rounds[3].alignments[18].hsps[0].query, "PASEGNPSDDPD------PLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIV")
12051         self.assertEqual(record.rounds[3].alignments[18].hsps[0].match, "PA  G P           P  + +Q LGE LYP+V   +   + KITGM                     RV EA+ ++ ")
12052         self.assertEqual(record.rounds[3].alignments[18].hsps[0].sbjct, "PAVPGMPERFTAADLAAVPEESRKQVLGELLYPKVFVREEKLSGKITGMLLEMPNSELLELLEDDSALNERVNEAIGVLQ")
12053         self.assertEqual(record.rounds[3].alignments[18].hsps[0].query_start, 468)
12054         self.assertEqual(record.rounds[3].alignments[18].hsps[0].query_end, 541)
12055         self.assertEqual(record.rounds[3].alignments[18].hsps[0].sbjct_start, 563)
12056         self.assertEqual(record.rounds[3].alignments[18].hsps[0].sbjct_end, 642)
12057         self.assertEqual(record.rounds[3].alignments[19].hsps[0].query, "PDPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELI")
12058         self.assertEqual(record.rounds[3].alignments[19].hsps[0].match, "       R  LGE LYP V+ ++   A+K+TGM                   +A+V EAM+++")
12059         self.assertEqual(record.rounds[3].alignments[19].hsps[0].sbjct, "NATPEQQRTMLGEVLYPLVEQVEAESAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVL")
12060         self.assertEqual(record.rounds[3].alignments[19].hsps[0].query_start, 478)
12061         self.assertEqual(record.rounds[3].alignments[19].hsps[0].query_end, 540)
12062         self.assertEqual(record.rounds[3].alignments[19].hsps[0].sbjct_start, 549)
12063         self.assertEqual(record.rounds[3].alignments[19].hsps[0].sbjct_end, 611)
12064         self.assertEqual(record.rounds[3].alignments[20].hsps[0].query, "DPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELI")
12065         self.assertEqual(record.rounds[3].alignments[20].hsps[0].match, "     H + LG+ LYP V+  +PA  +K+TGM                   +A+V EA++++")
12066         self.assertEqual(record.rounds[3].alignments[20].hsps[0].sbjct, "ASPDKHPRMLGDHLYPLVEQQEPANPAKVTGMLLEMDQAEILHLLESPEALKAKVSEALDVL")
12067         self.assertEqual(record.rounds[3].alignments[20].hsps[0].query_start, 479)
12068         self.assertEqual(record.rounds[3].alignments[20].hsps[0].query_end, 540)
12069         self.assertEqual(record.rounds[3].alignments[20].hsps[0].sbjct_start, 585)
12070         self.assertEqual(record.rounds[3].alignments[20].hsps[0].sbjct_end, 646)
12071         self.assertEqual(record.rounds[3].alignments[21].hsps[0].query, "PASEGNPSDDPDP----LPAHRQALGERLYPRVQAM--QPAFASKITGM")
12072         self.assertEqual(record.rounds[3].alignments[21].hsps[0].match, "P   G P +  D         RQALGE+LY +V A       A KITGM")
12073         self.assertEqual(record.rounds[3].alignments[21].hsps[0].sbjct, "PPQGGFPRNANDNNQFYQQKQRQALGEQLYKKVSAKTSNEEAAGKITGM")
12074         self.assertEqual(record.rounds[3].alignments[21].hsps[0].query_start, 468)
12075         self.assertEqual(record.rounds[3].alignments[21].hsps[0].query_end, 510)
12076         self.assertEqual(record.rounds[3].alignments[21].hsps[0].sbjct_start, 484)
12077         self.assertEqual(record.rounds[3].alignments[21].hsps[0].sbjct_end, 532)
12078         self.assertEqual(record.rounds[3].alignments[22].hsps[0].query, "SAMDLAFAVDLCKEEGGGQ---VELIPNGVNIPVTPQNVYEYVRKY-AEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCG")
12079         self.assertEqual(record.rounds[3].alignments[22].hsps[0].match, "    L F +D  K         +EL P G            YV      + +    E    A ++G     P  +L  L  E     +    ")
12080         self.assertEqual(record.rounds[3].alignments[22].hsps[0].sbjct, "LREQLCFTIDPEKAGDFDDAVAIELTPEGY--------YKLYVHIADVSYYVREGTETDKEAYKRGFTYYFPDRALHML-PEKLSAKLCSLR")
12081         self.assertEqual(record.rounds[3].alignments[22].hsps[0].query_start, 686)
12082         self.assertEqual(record.rounds[3].alignments[22].hsps[0].query_end, 773)
12083         self.assertEqual(record.rounds[3].alignments[22].hsps[0].sbjct_start, 243)
12084         self.assertEqual(record.rounds[3].alignments[22].hsps[0].sbjct_end, 325)
12085         self.assertEqual(record.rounds[3].alignments[23].hsps[0].query, "LAEEADSSKPGPSAHDVAAQLKSSLLAEIGLTESEGPPLTSFRPQCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKE")
12086         self.assertEqual(record.rounds[3].alignments[23].hsps[0].match, "+A +  S+  GP +      ++ S  A++   E+  P  T  RP  +  G V S      +W    E   R F         S  + L  F+  E")
12087         self.assertEqual(record.rounds[3].alignments[23].hsps[0].sbjct, "VASQYSSTPSGPVSVSAMRAVQRSFSAQLAHNEARQPEPTYLRPVSTSYGPVPSTQSAQEQWYSPTEAQFRAFTAAHSMPTTSAQSPLTTFDTPE")
12088         self.assertEqual(record.rounds[3].alignments[23].hsps[0].query_start, 219)
12089         self.assertEqual(record.rounds[3].alignments[23].hsps[0].query_end, 313)
12090         self.assertEqual(record.rounds[3].alignments[23].hsps[0].sbjct_start, 702)
12091         self.assertEqual(record.rounds[3].alignments[23].hsps[0].sbjct_end, 796)
12092         self.assertEqual(record.rounds[4].alignments[0].hsps[0].query, "MMSARGDFLNYALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQALIYWIKAMNQQTTLDTPQXXXXXXXXXXXXGIXXXXXXXXXXXXTSQSATLNDKDDESLPAETGQNHPFFRRSDSMTFLGCIPPNPFEVPLAEAIPLADQPHLLQPNARKEDLFGRPSQGLYSSSAGSGKCLVEVTMDRNCLEVLPTKMSYAANLKNVMNMQNRQKKAGEDQSMLAEEADSSKPGPSAHDVAAQLKSSLLAEIGLTESEGPPLTSFRPQCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKESKFRREMEKLRNQQSRDLSLEVDRDRDLLIQQTMRQLNNHFGRRCATTPMAVHRVKVTFKDEPGEGSGVARSFYTAIAQAFLSNEKLPNLDCIQNANKGTHTSLMQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSIDTRPFRPASEGNPSDDPDPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGAXXXXXXXXXXXXEKVQENRKRHGSSRSVVXXXXXXXXXXXXNAPLFYQPGKRGFYTPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVPXXXXXXXXXXXXXXXXXXXNFGFV")
12093         self.assertEqual(record.rounds[4].alignments[0].hsps[0].match, "MMSARGDFLNYALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQALIYWIKAMNQQTTLDTPQ            GI            TSQSATLNDKDDESLPAETGQNHPFFRRSDSMTFLGCIPPNPFEVPLAEAIPLADQPHLLQPNARKEDLFGRPSQGLYSSSAGSGKCLVEVTMDRNCLEVLPTKMSYAANLKNVMNMQNRQKKAGEDQSMLAEEADSSKPGPSAHDVAAQLKSSLLAEIGLTESEGPPLTSFRPQCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKESKFRREMEKLRNQQSRDLSLEVDRDRDLLIQQTMRQLNNHFGRRCATTPMAVHRVKVTFKDEPGEGSGVARSFYTAIAQAFLSNEKLPNLDCIQNANKGTHTSLMQ                                      QLSIDTRPFRPASEGNPSDDPDPLPAHRQALGERLYPRVQAMQPAFASKITGM                   RARVEEAMELIVAHGRENGA            EKVQENRKRHGSSRSVV            NAPLFYQPGKRGFYTPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVP                   NFGFV")
12094         self.assertEqual(record.rounds[4].alignments[0].hsps[0].sbjct, "MMSARGDFLNYALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQALIYWIKAMNQQTTLDTPQLERKRTRELLELGIDNEDSEHENDDDTSQSATLNDKDDESLPAETGQNHPFFRRSDSMTFLGCIPPNPFEVPLAEAIPLADQPHLLQPNARKEDLFGRPSQGLYSSSAGSGKCLVEVTMDRNCLEVLPTKMSYAANLKNVMNMQNRQKKAGEDQSMLAEEADSSKPGPSAHDVAAQLKSSLLAEIGLTESEGPPLTSFRPQCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKESKFRREMEKLRNQQSRDLSLEVDRDRDLLIQQTMRQLNNHFGRRCATTPMAVHRVKVTFKDEPGEGSGVARSFYTAIAQAFLSNEKLPNLDCIQNANKGTHTSLMQRLRNRGERDREREREREMRRSSGLRAGSRRDRDRDFRRQLSIDTRPFRPASEGNPSDDPDPLPAHRQALGERLYPRVQAMQPAFASKITGMLLELSPAQLLLLLASEDSLRARVEEAMELIVAHGRENGADSILDLGLLDSSEKVQENRKRHGSSRSVVDMDLDDTDDGDDNAPLFYQPGKRGFYTPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVPLYSSKQILKQKLLLAIKTKNFGFV")
12095         self.assertEqual(record.rounds[4].alignments[0].hsps[0].query_start, 1)
12096         self.assertEqual(record.rounds[4].alignments[0].hsps[0].query_end, 889)
12097         self.assertEqual(record.rounds[4].alignments[0].hsps[0].sbjct_start, 1)
12098         self.assertEqual(record.rounds[4].alignments[0].hsps[0].sbjct_end, 889)
12099         self.assertEqual(record.rounds[4].alignments[1].hsps[0].query, "QCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKESKFRREMEKLRNQQSRDLSL-EVDRDRDLLIQQTMRQLNNHFGR--RCATTPMAVHRVKVTFKDEPGEGSGVARSFYTAIAQAFLSNEKLPNLDCIQNANKGTHTSLMQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLSIDTRPFRPASEGN---PSDDPDPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGAXXXXXXXXXXXXEKVQENRKRHGSSRSVVXXXXXXXXXXXXNAPLFYQPGKRGFYTPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRM-LVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLL-QFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVPXXXXXXXXXXXXXXXXXXXNFGFV")
12100         self.assertEqual(record.rounds[4].alignments[1].hsps[0].match, "Q +F G+   + +L  +  L+L+LFGR FM+DVG E GS+L EL GF VKE +FRR MEKLRN Q RDL L +++R+R+ LI QT ++LN  FG   R    P+  +RVKVTFKDEPGEGSGVARSFYT+IA+A L++ K+PNL+ +Q      H+  +                                        L++D RP+ P +  +   P    D L  H Q +GERLYP++ ++    A KITGM                   R +V EA+E+I    +   +               Q ++ +   S  VV            N PLFY PGKRGFY PR G  +  R+N FRNIGR++GLCLLQNEL P+ L RHV+K +L RK+ +HD AFFDP +YES RQ+I  +Q+ + +   + M+L F +DL KEEG G  ELIP G ++ V+ + +Y       ++   +   E+ L A++ G+ DVLP NS+ +LTAED RLL+NG G++NV  LIS+T+FNDES E  +K L +FK+WFWSIVE+M++ ERQ LVYFWT SP+LPASEEGFQP+PS+TIRP DD HLPTANTCISRLY+P                   NFGFV")
12101         self.assertEqual(record.rounds[4].alignments[1].hsps[0].sbjct, "QSNFSGIAPCNFLLSAK--LTLDLFGRPFMDDVGMEHGSVLPELRGFPVKEMRFRRHMEKLRNGQQRDLVLCKLERNRESLIVQTFKELNTQFGNQSRRIQPPITFNRVKVTFKDEPGEGSGVARSFYTSIAEALLASAKIPNLESVQVGTN--HSKYVVPFSSILRTTVSGSSRDQSTLQRRGSNSKILWRSARERKALNLDARPYTPPNSSDNATPESLNDHLSVHLQQIGERLYPKIHSINQTHAPKITGMLLEIPTPQLLSVISSDETLRQKVNEAIEIITFKQKSETSA--------------QSSQPKKSPSVVVVDPVDDD------NEPLFYSPGKRGFYIPRQGFASFERINAFRNIGRLIGLCLLQNELLPLFLQRHVLKYILRRKIKFHDLAFFDPALYESFRQIIQNAQTKEGEETINRMELCFVIDLMKEEGCGNRELIPGGRDV-VSHRVIYSSTSDAIQNIDXIKSQEKALEALKDGVFDVLPDNSMINLTAEDLRLLLNGVGDINVSTLISYTTFNDESSEGPDK-LXKFKKWFWSIVEKMNIMERQHLVYFWTGSPALPASEEGFQPLPSVTIRPADDSHLPTANTCISRLYIPLYSSKSILRSKMLMAIKSKNFGFV")
12102         self.assertEqual(record.rounds[4].alignments[1].hsps[0].query_start, 263)
12103         self.assertEqual(record.rounds[4].alignments[1].hsps[0].query_end, 889)
12104         self.assertEqual(record.rounds[4].alignments[1].hsps[0].sbjct_start, 2287)
12105         self.assertEqual(record.rounds[4].alignments[1].hsps[0].sbjct_end, 2895)
12106         self.assertEqual(record.rounds[4].alignments[1].hsps[1].query, "SARGDFLNYALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQALIYWIKAMNQQTTLDTPQXXXXXXXXXXXXGIXXXXXXXXXXXXTSQSATLNDKDDE------SLPA--ETGQNHPFFRRSDSMTFLGCIPPNPFEVPLAEAIPLADQPHLLQPNARKEDLFGRPSQGLYSSSAGSGKCLVEVTMD---RNCLEVLPTKMSYAANLK")
12107         self.assertEqual(record.rounds[4].alignments[1].hsps[1].match, "++R DF  Y LSLMRSH  EH D LPVLD+ +L+H+AYV  A +Y+++  N     D                I              + A L + + +      S+P+  +  + H FF RS+S   LGC  P  FE+PL  A+PLAD+PHLLQPN+++++LF      + +++  SG      T D    +  +  PT++ ++ +LK")
12108         self.assertEqual(record.rounds[4].alignments[1].hsps[1].sbjct, "NSRRDFFTYCLSLMRSHTSEHRDALPVLDITALRHIAYVLDAFVYYMR--NDSGFYDKQDSISGR--------INNLSPMTESYDTDDELANLEEFNADVQMSASSMPSGSQGTRRHAFFARSESTLTLGCSAPEGFELPLDMAMPLADKPHLLQPNSKRQELFANLPLLVTTNANNSG-----ATNDGDGASIFDYTPTRLGFSNSLK")
12109         self.assertEqual(record.rounds[4].alignments[1].hsps[1].query_start, 3)
12110         self.assertEqual(record.rounds[4].alignments[1].hsps[1].query_end, 200)
12111         self.assertEqual(record.rounds[4].alignments[1].hsps[1].sbjct_start, 1913)
12112         self.assertEqual(record.rounds[4].alignments[1].hsps[1].sbjct_end, 2106)
12113         self.assertEqual(record.rounds[4].alignments[2].hsps[0].query, "PRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASE----EGFQPMPSITIRPP-DDQHLPTANTCISRLYVP")
12114         self.assertEqual(record.rounds[4].alignments[2].hsps[0].match, "P  G N E  LN F+ IGR++GL +               K++L +KV   D    D   Y SL  ++    +   D  FS  D  F   +        ++L PNG NI VT +N  EYV      R+    E+  +A  +G  +++P+  +      +  LL+ G  E++++     T +   S  +     Q  +WFW +++  S  ++  L+ F T +  +P +     +G       TI    +   LP A+TC +RL +P")
12115         self.assertEqual(record.rounds[4].alignments[2].hsps[0].sbjct, "PHSGINPE-HLNYFKFIGRVIGLAIFHRRFVDAFFVVSFYKMILQKKVTLQDMESMDAEYYRSLVWILDNDITGVLDLTFSVEDNCFGEVVT-------IDLKPNGRNIEVTEENKREYVDLVTVWRIQKRIEEQFNAFHEGFSELIPQELINVFDERELELLIGGISEIDMEDWKKHTDYRSYSEND-----QIIKWFWELMDEWSNEKKSRLLQFTTGTSRIPVNGFKDLQGSDGPRKFTIEKAGEPNKLPKAHTCFNRLDLP")
12116         self.assertEqual(record.rounds[4].alignments[2].hsps[0].query_start, 606)
12117         self.assertEqual(record.rounds[4].alignments[2].hsps[0].query_end, 865)
12118         self.assertEqual(record.rounds[4].alignments[2].hsps[0].sbjct_start, 491)
12119         self.assertEqual(record.rounds[4].alignments[2].hsps[0].sbjct_end, 742)
12120         self.assertEqual(record.rounds[4].alignments[3].hsps[0].query, "PRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQV---ELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASE----EGFQPMPSITIRP-PDDQHLPTANTCISRLYVP")
12121         self.assertEqual(record.rounds[4].alignments[3].hsps[0].match, "P  G   E  L+ F+ IGR+ G+ +   +L      R   K++L + +  HD    D   Y SLR ++    +         +DL F +D   EE  GQ    EL   G  I VT +N  EY+    + R +   ++ + A ++G  +++P++ ++     +  LL+ G G+V+V      T + +    N     Q  +WFW  V  M   +R  L+ F T +  +P +      G     S T+      + LP A+TC +RL +P")
12122         self.assertEqual(record.rounds[4].alignments[3].hsps[0].sbjct, "PNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHDMESVDSEYYNSLRWILENDPTE--------LDLRFIID---EELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSANH----QVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLP")
12123         self.assertEqual(record.rounds[4].alignments[3].hsps[0].query_start, 606)
12124         self.assertEqual(record.rounds[4].alignments[3].hsps[0].query_end, 865)
12125         self.assertEqual(record.rounds[4].alignments[3].hsps[0].sbjct_start, 649)
12126         self.assertEqual(record.rounds[4].alignments[3].hsps[0].sbjct_end, 901)
12127         self.assertEqual(record.rounds[4].alignments[4].hsps[0].query, "PRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQV---ELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASE----EGFQPMPSITIRP-PDDQHLPTANTCISRLYVP")
12128         self.assertEqual(record.rounds[4].alignments[4].hsps[0].match, "P  G   E  L+ F+ IGR+ G+ +   +L      R   K++L + +  HD    D   Y SLR ++    +         +DL F +D   EE  GQ    EL   G  I VT +N  EY+    + R +   ++ + A ++G  +++P++ ++     +  LL+ G G+V+V      T + +    N     Q   WFW  V  M   +R  L+ F T +  +P +      G     S T+        LP A+TC +RL +P")
12129         self.assertEqual(record.rounds[4].alignments[4].hsps[0].sbjct, "PNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLQKLITLHDMESVDSEYYSSLRWILENDPTE--------LDLRFIID---EELFGQTHQHELKTGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSMNH----QVIHWFWKAVWMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPDKLPRAHTCFNRLDLP")
12130         self.assertEqual(record.rounds[4].alignments[4].hsps[0].query_start, 606)
12131         self.assertEqual(record.rounds[4].alignments[4].hsps[0].query_end, 865)
12132         self.assertEqual(record.rounds[4].alignments[4].hsps[0].sbjct_start, 679)
12133         self.assertEqual(record.rounds[4].alignments[4].hsps[0].sbjct_end, 931)
12134         self.assertEqual(record.rounds[4].alignments[5].hsps[0].query, "PRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASE----EGFQPMPSITIRPPDD-QHLPTANTCISRLYVP")
12135         self.assertEqual(record.rounds[4].alignments[5].hsps[0].match, "P  G N E  LN F+ IGR++GL +             + K++L +KV   D    D  +Y SL  ++  S     D  FSA D  F   +        V+L P+G NI VT  N  EYV  Y + R++   ++   A   G  +++P++ +      +  LL+ G  E++++     T +      +     +  +WFW  V      +R  L+ F T +  +P +     +G       TI    + Q LP ++TC +R+ +P")
12136         self.assertEqual(record.rounds[4].alignments[5].hsps[0].sbjct, "PNSGINPE-HLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKMMLRKKVVLQDMEGVDAEVYNSLNWMLENSIDGVLDLTFSADDERFGEVVT-------VDLKPDGRNIEVTDGNKKEYVELYTQWRIVDRVQEQFKAFMDGFNELIPEDLVTVFDERELELLIGGIAEIDIEDWKKHTDYRGYQESD-----EVIQWFWKCVSEWDNEQRARLLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKAGEVQQLPKSHTCFNRVDLP")
12137         self.assertEqual(record.rounds[4].alignments[5].hsps[0].query_start, 606)
12138         self.assertEqual(record.rounds[4].alignments[5].hsps[0].query_end, 865)
12139         self.assertEqual(record.rounds[4].alignments[5].hsps[0].sbjct_start, 533)
12140         self.assertEqual(record.rounds[4].alignments[5].hsps[0].sbjct_end, 784)
12141         self.assertEqual(record.rounds[4].alignments[6].hsps[0].query, "FRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQV-ELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLED-LTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVP")
12142         self.assertEqual(record.rounds[4].alignments[6].hsps[0].match, "F  IG +LGL +  N +  +     V + L+G+K  + D     PV+Y+SL+ L+    + + D     M + F +      G   + +L  NG  IP+T +N  E+V  Y+++ +    E+   A R+G   V  ++ L+     E+  LL+ G   ++ Q L   T +  + G   + +L   R FW IV   +  +++  + F T +   P    G   M  I    PD + LPT++TC + L +P")
12143         self.assertEqual(record.rounds[4].alignments[6].hsps[0].sbjct, "FTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGNVEDD-----MMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEY--DGGYTRDSVL--IREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKM-IIAKNGPDTERLPTSHTCFNVLLLP")
12144         self.assertEqual(record.rounds[4].alignments[6].hsps[0].query_start, 619)
12145         self.assertEqual(record.rounds[4].alignments[6].hsps[0].query_end, 865)
12146         self.assertEqual(record.rounds[4].alignments[6].hsps[0].sbjct_start, 612)
12147         self.assertEqual(record.rounds[4].alignments[6].hsps[0].sbjct_end, 850)
12148         self.assertEqual(record.rounds[4].alignments[7].hsps[0].query, "FRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQV-ELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLED-LTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVP")
12149         self.assertEqual(record.rounds[4].alignments[7].hsps[0].match, "F  IG + GL +  N +  +     V + L+G+K  + D     PV+Y+SL+ L+    S + D     M + F +      G   + +L  NG  IP+T +N  E+V  Y+++ +    E+   A R+G   V  ++ L+     E+  LL+ G   ++ Q L   T +  + G   E +    R FW IV   +  +++  + F T +   P    G   M  I    PD + LPT++TC + L +P")
12150         self.assertEqual(record.rounds[4].alignments[7].hsps[0].sbjct, "FTLIGIL-GLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGSVEDD-----MMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVISYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEY--DGGYTRESV--VIREFWEIVHSFTDEQKRLFLLFTTGTDRAPVGGLGKLKM-IIAKNGPDTERLPTSHTCFNVLLLP")
12151         self.assertEqual(record.rounds[4].alignments[7].hsps[0].query_start, 619)
12152         self.assertEqual(record.rounds[4].alignments[7].hsps[0].query_end, 865)
12153         self.assertEqual(record.rounds[4].alignments[7].hsps[0].sbjct_start, 623)
12154         self.assertEqual(record.rounds[4].alignments[7].hsps[0].sbjct_end, 860)
12155         self.assertEqual(record.rounds[4].alignments[8].hsps[0].query, "YTPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAV------DLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPK-NSLEDLTAEDFRLLVNGCGE---VNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYV")
12156         self.assertEqual(record.rounds[4].alignments[8].hsps[0].match, "+    GKN++  L  +   G ++GL +  + +  +   + + K L    +++ D++   P    +L +++  ++ +  D      +  +        D    +    VEL  NG N+P+T  N +E+V K+ E  +    E   +    G   V  + NS++   +E+   LV G  E    + + L S T +     +++  +     WFW I+E      ++ L+ F T+S  +PA+     P     +   D   LP A+TC + + +")
12157         self.assertEqual(record.rounds[4].alignments[8].hsps[0].sbjct, "FDKSKGKNSQLEL--YYLFGVVMGLAIFNSTILDLQFPKALYKKLCSEPLSFEDYSELFPETSRNLIKMLNYTEDNFEDVFSLTFETTYRNNNWILNDSKSSKEYVTVELCENGRNVPITQSNKHEFVMKWVEFYLEKSIEPQYNKFVSGFKRVFAECNSIKLFNSEELERLVCGDEEQTKFDFKSLRSVTKYVGGFSDDSRAVC----WFWEIIESWDYPLQKKLLQFVTASDRIPATGISTIPFKISLLGSHDSDDLPLAHTCFNEICL")
12158         self.assertEqual(record.rounds[4].alignments[8].hsps[0].query_start, 604)
12159         self.assertEqual(record.rounds[4].alignments[8].hsps[0].query_end, 864)
12160         self.assertEqual(record.rounds[4].alignments[8].hsps[0].sbjct_start, 602)
12161         self.assertEqual(record.rounds[4].alignments[8].hsps[0].sbjct_end, 866)
12162         self.assertEqual(record.rounds[4].alignments[9].hsps[0].query, "TPRPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNW--HDFAFFDPVMYES---LRQLILASQSSDADAVFSAMDLAFAVDL-----CKEE---------GGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRP------PDDQHLPTANTCISRLYVP")
12163         self.assertEqual(record.rounds[4].alignments[9].hsps[0].match, "T +P    + ++  FR +G+++   ++   L  + L     K +L ++ +   HD    DPV+  S   L  ++   +  + D   +   L +A++      C  E         G   +EL   G +IPVT  N+ EY+R      +     +   + R G   V P + L+    E+   L+ G                 + G   +   +  ++ + I+      +++  + F T SP LP         P   +R         D  LP+  TC++ L +P")
12164         self.assertEqual(record.rounds[4].alignments[9].hsps[0].sbjct, "TAKPAHIAKVKMK-FRFLGKLMAKAIMDFRLVDLPLGLPFYKWMLRQETSLTSHDLFDIDPVVARSVYHLEDIVRQKKRLEQDKSQTKESLQYALETLTMNGCSVEDLGLDFTLPGFPNIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVSRQFDSFRDGFESVFPLSHLQYFYPEELDQLLCGSKADTWDAKTLMECCRPDHGYTHDS--RAVKFLFEILSSFDNEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLKLP")
12165         self.assertEqual(record.rounds[4].alignments[9].hsps[0].query_start, 605)
12166         self.assertEqual(record.rounds[4].alignments[9].hsps[0].query_end, 865)
12167         self.assertEqual(record.rounds[4].alignments[9].hsps[0].sbjct_start, 1684)
12168         self.assertEqual(record.rounds[4].alignments[9].hsps[0].sbjct_end, 1966)
12169         self.assertEqual(record.rounds[4].alignments[10].hsps[0].query, "GRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQV-ELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASE----EGFQPMPSITIRPPD--DQHLPTANTCISRLYVP")
12170         self.assertEqual(record.rounds[4].alignments[10].hsps[0].match, "GR +   ++   L      R   K +LG+ V + D    D   Y+ L  L+        D      DL F+ ++ +E G  +V +L PNG NI VT +N  EYV    + RM     + L A  +G  +++PK  +   T ++  LL  G   +++  L S T ++     + +      +WFW  +      +R   + F T +  +P       EG   +    I   D     LP+A+TC ++L +P")
12171         self.assertEqual(record.rounds[4].alignments[10].hsps[0].sbjct, "GRYVAKAVMTTALLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLEN------DVSTLGYDLTFSTEV-QEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLYTGLPTIDIDDLKSNTEYHKYQSNSIQ-----IQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLP")
12172         self.assertEqual(record.rounds[4].alignments[10].hsps[0].query_start, 623)
12173         self.assertEqual(record.rounds[4].alignments[10].hsps[0].query_end, 865)
12174         self.assertEqual(record.rounds[4].alignments[10].hsps[0].sbjct_start, 45)
12175         self.assertEqual(record.rounds[4].alignments[10].hsps[0].sbjct_end, 282)
12176         self.assertEqual(record.rounds[4].alignments[11].hsps[0].query, "EARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGG--QVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPS-ITIRPPDDQHLPTANTCISRLYVP")
12177         self.assertEqual(record.rounds[4].alignments[11].hsps[0].match, "    N F  IG   GL +  + +  +     + K LL  K    D     P    SL++L+      D +  F    L F +  C+E  G   Q +LIP G N+ V   N  E+V  Y  +   +   +   A   G L V     LE     + R ++ G    N + L     +  +       +    + FW       + +++  + F T S  +P    G   +   I      +++LP A+TC + L +P")
12178         self.assertEqual(record.rounds[4].alignments[11].hsps[0].sbjct, "FVEHNWFHLIGITCGLAIYNSTVVDLHFPLALYKKLLNVKPGLEDLKELSPTEGRSLQELLDY-PGEDVEETFC---LNFTI--CRESYGVIEQKKLIPGGDNVTVCKDNRQEFVDAYVNYVFQISVHEWYTAFSSGFLKVCGGKVLELFQPSELRAMMVGNSNYNWEELEETAIYKGDYSATHPTV----KLFWETFHEFPLEKKKKFLLFLTGSDRIPI--YGMASLQIVIQSTASGEEYLPVAHTCYNLLDLP")
12179         self.assertEqual(record.rounds[4].alignments[11].hsps[0].query_start, 613)
12180         self.assertEqual(record.rounds[4].alignments[11].hsps[0].query_end, 865)
12181         self.assertEqual(record.rounds[4].alignments[11].hsps[0].sbjct_start, 782)
12182         self.assertEqual(record.rounds[4].alignments[11].hsps[0].sbjct_end, 1025)
12183         self.assertEqual(record.rounds[4].alignments[12].hsps[0].query, "RPGKNTEARLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLLG------------RKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASE-EGFQPMPSITIRPPD-----DQHLPTANTCISRLYVP")
12184         self.assertEqual(record.rounds[4].alignments[12].hsps[0].match, " P  N E  +  F  +G  +   LL N +     ++   ++L               +         DP++ +SL+ ++      D +    ++ L F V      G   +ELIP G N  +   NV EY+    +  +    E+ L A  +G   V     +  L  ++  + + G  E +  M   +T+ N E G   +  +     F SI+      ER+  + F T SP LP    +   P  ++ ++  +     D++LP+  TC + L +P")
12185         self.assertEqual(record.rounds[4].alignments[12].hsps[0].sbjct, "NPFSNNEKVIELFGYLGTFVARSLLDNRILDFRFSKVFFELLHRMSTPNVTTVPSDVETCLLMIELVDPLLAKSLKYIVAN---KDDNMTLESLSLTFTVP-----GNDDIELIPGGCNKSLNSSNVEEYIHGVIDQILGKGIEKQLKAFIEGFSKVFSYERMLILFPDEL-VDIFGRVEEDWSMATLYTNLNAEHGYTMDSSI--IHDFISIISAFGKHERRLFLQFLTGSPKLPIGGFKSLNPKFTVVLKHAEDGLTADEYLPSVMTCANYLKLP")
12186         self.assertEqual(record.rounds[4].alignments[12].hsps[0].query_start, 607)
12187         self.assertEqual(record.rounds[4].alignments[12].hsps[0].query_end, 865)
12188         self.assertEqual(record.rounds[4].alignments[12].hsps[0].sbjct_start, 1192)
12189         self.assertEqual(record.rounds[4].alignments[12].hsps[0].sbjct_end, 1457)
12190         self.assertEqual(record.rounds[4].alignments[13].hsps[0].query, "RLNCFRNIGRILGLCLLQNELCPITLNRHVIKVLL----GRKVNWHDFAFFDPVMYESLRQLILASQSSDADAVFSAMDLAFAVDLCKEEGGGQVELIPNGVNIPVTPQNVYEYVRKYAEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCG-EVNVQMLISFTSFNDESGENAEKLLQFKRWFWSIVERMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQ--HLPTANTCISRLYVP")
12191         self.assertEqual(record.rounds[4].alignments[13].hsps[0].match, "+L     +G+++G CL ++ L  ++     +K LL    G   ++ D   +D V+Y +L +L+    ++D      ++DL F +D   E     V+LIPNG    VT  NV  YV K  ++++     +P+ A   GL  ++  + +E   + + ++L++G    +++  L S T +     E+     Q    FW ++      E+ + + F TS P  P         P   IR    +   LPTA+TC++ L +P")
12192         self.assertEqual(record.rounds[4].alignments[13].hsps[0].sbjct, "KLKYIWFLGKVVGKCLYEHVLIDVSFADFFLKKLLNYSNGFLSSFSDLGSYDSVLYNNLIKLLN--MTTDE---IKSLDLTFEIDE-PESSAKVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWMEMFNSIELQMLISGERDNIDLDDLKSNTEYGGYKEED-----QTIVDFWEVLNEFKFEEKLNFLKFVTSVPQAPLQGFKALD-PKFGIRNAGTEKYRLPTASTCVNLLKLP")
12193         self.assertEqual(record.rounds[4].alignments[13].hsps[0].query_start, 615)
12194         self.assertEqual(record.rounds[4].alignments[13].hsps[0].query_end, 865)
12195         self.assertEqual(record.rounds[4].alignments[13].hsps[0].sbjct_start, 640)
12196         self.assertEqual(record.rounds[4].alignments[13].hsps[0].sbjct_end, 885)
12197         self.assertEqual(record.rounds[4].alignments[14].hsps[0].query, "DPDPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGA")
12198         self.assertEqual(record.rounds[4].alignments[14].hsps[0].match, "        +Q LGERLYP ++ M    A KITGM                   +A+VEEA+ ++  H     A")
12199         self.assertEqual(record.rounds[4].alignments[14].hsps[0].sbjct, "ANAKPQEQKQILGERLYPMIEHMHANLAGKITGMLLEIENSELLHMIEDQEALKAKVEEAVAVLQVHRVTEPA")
12200         self.assertEqual(record.rounds[4].alignments[14].hsps[0].query_start, 477)
12201         self.assertEqual(record.rounds[4].alignments[14].hsps[0].query_end, 549)
12202         self.assertEqual(record.rounds[4].alignments[14].hsps[0].sbjct_start, 559)
12203         self.assertEqual(record.rounds[4].alignments[14].hsps[0].sbjct_end, 631)
12204         self.assertEqual(record.rounds[4].alignments[15].hsps[0].query, "DPDPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGA")
12205         self.assertEqual(record.rounds[4].alignments[15].hsps[0].match, "   P    +Q LGERL+P +QAM P  A KITGM                   R++V+EA+ ++ AH  +  A")
12206         self.assertEqual(record.rounds[4].alignments[15].hsps[0].sbjct, "ASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAA")
12207         self.assertEqual(record.rounds[4].alignments[15].hsps[0].query_start, 477)
12208         self.assertEqual(record.rounds[4].alignments[15].hsps[0].query_end, 549)
12209         self.assertEqual(record.rounds[4].alignments[15].hsps[0].sbjct_start, 551)
12210         self.assertEqual(record.rounds[4].alignments[15].hsps[0].sbjct_end, 623)
12211         self.assertEqual(record.rounds[4].alignments[16].hsps[0].query, "DPDPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGA")
12212         self.assertEqual(record.rounds[4].alignments[16].hsps[0].match, "   P    +Q LGERL+P +QAM P+ A KITGM                   R++V+EA+ ++ AH  +  A")
12213         self.assertEqual(record.rounds[4].alignments[16].hsps[0].sbjct, "ASAPPQEQKQMLGERLFPLIQAMHPSLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAA")
12214         self.assertEqual(record.rounds[4].alignments[16].hsps[0].query_start, 477)
12215         self.assertEqual(record.rounds[4].alignments[16].hsps[0].query_end, 549)
12216         self.assertEqual(record.rounds[4].alignments[16].hsps[0].sbjct_start, 551)
12217         self.assertEqual(record.rounds[4].alignments[16].hsps[0].sbjct_end, 623)
12218         self.assertEqual(record.rounds[4].alignments[17].hsps[0].query, "DPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIVAHGRENGA")
12219         self.assertEqual(record.rounds[4].alignments[17].hsps[0].match, " P    +Q LGERL+P +QAM P  A KITGM                   R +V+EA+ ++ AH  +  A")
12220         self.assertEqual(record.rounds[4].alignments[17].hsps[0].sbjct, "APPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESPESLRLKVDEAVAVLQAHQAKEAA")
12221         self.assertEqual(record.rounds[4].alignments[17].hsps[0].query_start, 479)
12222         self.assertEqual(record.rounds[4].alignments[17].hsps[0].query_end, 549)
12223         self.assertEqual(record.rounds[4].alignments[17].hsps[0].sbjct_start, 551)
12224         self.assertEqual(record.rounds[4].alignments[17].hsps[0].sbjct_end, 621)
12225         self.assertEqual(record.rounds[4].alignments[18].hsps[0].query, "PASEGNPSDDPD------PLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELIV")
12226         self.assertEqual(record.rounds[4].alignments[18].hsps[0].match, "PA  G P           P  + +Q LGE LYP+V   +   + KITGM                     RV EA+ ++ ")
12227         self.assertEqual(record.rounds[4].alignments[18].hsps[0].sbjct, "PAVPGMPERFTAADLAAVPEESRKQVLGELLYPKVFVREEKLSGKITGMLLEMPNSELLELLEDDSALNERVNEAIGVLQ")
12228         self.assertEqual(record.rounds[4].alignments[18].hsps[0].query_start, 468)
12229         self.assertEqual(record.rounds[4].alignments[18].hsps[0].query_end, 541)
12230         self.assertEqual(record.rounds[4].alignments[18].hsps[0].sbjct_start, 563)
12231         self.assertEqual(record.rounds[4].alignments[18].hsps[0].sbjct_end, 642)
12232         self.assertEqual(record.rounds[4].alignments[19].hsps[0].query, "PDPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELI")
12233         self.assertEqual(record.rounds[4].alignments[19].hsps[0].match, "       R  LGE LYP V+ ++   A+K+TGM                   +A+V EAM+++")
12234         self.assertEqual(record.rounds[4].alignments[19].hsps[0].sbjct, "NATPEQQRTMLGEVLYPLVEQVEAESAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVL")
12235         self.assertEqual(record.rounds[4].alignments[19].hsps[0].query_start, 478)
12236         self.assertEqual(record.rounds[4].alignments[19].hsps[0].query_end, 540)
12237         self.assertEqual(record.rounds[4].alignments[19].hsps[0].sbjct_start, 549)
12238         self.assertEqual(record.rounds[4].alignments[19].hsps[0].sbjct_end, 611)
12239         self.assertEqual(record.rounds[4].alignments[20].hsps[0].query, "DPLPAHRQALGERLYPRVQAMQPAFASKITGMXXXXXXXXXXXXXXXXXXXRARVEEAMELI")
12240         self.assertEqual(record.rounds[4].alignments[20].hsps[0].match, "     H + LG+ LYP V+  +PA  +K+TGM                   +A+V EA++++")
12241         self.assertEqual(record.rounds[4].alignments[20].hsps[0].sbjct, "ASPDKHPRMLGDHLYPLVEQQEPANPAKVTGMLLEMDQAEILHLLESPEALKAKVSEALDVL")
12242         self.assertEqual(record.rounds[4].alignments[20].hsps[0].query_start, 479)
12243         self.assertEqual(record.rounds[4].alignments[20].hsps[0].query_end, 540)
12244         self.assertEqual(record.rounds[4].alignments[20].hsps[0].sbjct_start, 585)
12245         self.assertEqual(record.rounds[4].alignments[20].hsps[0].sbjct_end, 646)
12246         self.assertEqual(record.rounds[4].alignments[21].hsps[0].query, "PASEGNPSDDPDP----LPAHRQALGERLYPRVQAM--QPAFASKITGM")
12247         self.assertEqual(record.rounds[4].alignments[21].hsps[0].match, "P   G P +  D         RQALGE+LY +V A       A KITGM")
12248         self.assertEqual(record.rounds[4].alignments[21].hsps[0].sbjct, "PPQGGFPRNANDNNQFYQQKQRQALGEQLYKKVSAKTSNEEAAGKITGM")
12249         self.assertEqual(record.rounds[4].alignments[21].hsps[0].query_start, 468)
12250         self.assertEqual(record.rounds[4].alignments[21].hsps[0].query_end, 510)
12251         self.assertEqual(record.rounds[4].alignments[21].hsps[0].sbjct_start, 484)
12252         self.assertEqual(record.rounds[4].alignments[21].hsps[0].sbjct_end, 532)
12253         self.assertEqual(record.rounds[4].alignments[22].hsps[0].query, "SAMDLAFAVDLCKEEGGGQ---VELIPNGVNIPVTPQNVYEYVRKY-AEHRMLVVAEQPLHAMRKGLLDVLPKNSLEDLTAEDFRLLVNGCG")
12254         self.assertEqual(record.rounds[4].alignments[22].hsps[0].match, "    L F +D  K         +EL P G            YV      + +    E    A ++G     P  +L  L  E     +    ")
12255         self.assertEqual(record.rounds[4].alignments[22].hsps[0].sbjct, "LREQLCFTIDPEKAGDFDDAVAIELTPEGY--------YKLYVHIADVSYYVREGTETDKEAYKRGFTYYFPDRALHML-PEKLSAKLCSLR")
12256         self.assertEqual(record.rounds[4].alignments[22].hsps[0].query_start, 686)
12257         self.assertEqual(record.rounds[4].alignments[22].hsps[0].query_end, 773)
12258         self.assertEqual(record.rounds[4].alignments[22].hsps[0].sbjct_start, 243)
12259         self.assertEqual(record.rounds[4].alignments[22].hsps[0].sbjct_end, 325)
12260         self.assertEqual(record.rounds[4].alignments[23].hsps[0].query, "LAEEADSSKPGPSAHDVAAQLKSSLLAEIGLTESEGPPLTSFRPQCSFMGMVISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKE")
12261         self.assertEqual(record.rounds[4].alignments[23].hsps[0].match, "+A +  S+  GP +      ++ S  A++   E+  P  T  RP  +  G V S      +W    E   R F         S  + L  F+  E")
12262         self.assertEqual(record.rounds[4].alignments[23].hsps[0].sbjct, "VASQYSSTPSGPVSVSAMRAVQRSFSAQLAHNEARQPEPTYLRPVSTSYGPVPSTQSAQEQWYSPTEAQFRAFTAAHSMPTTSAQSPLTTFDTPE")
12263         self.assertEqual(record.rounds[4].alignments[23].hsps[0].query_start, 219)
12264         self.assertEqual(record.rounds[4].alignments[23].hsps[0].query_end, 313)
12265         self.assertEqual(record.rounds[4].alignments[23].hsps[0].sbjct_start, 702)
12266         self.assertEqual(record.rounds[4].alignments[23].hsps[0].sbjct_end, 796)

Here is the caller graph for this function:

def test_NCBITextParser.TestNCBITextParser._check_bt060_round0 (   self,
  record 
) [private]

Definition at line 10077 of file test_NCBITextParser.py.

10077 
10078     def _check_bt060_round0(self, record):
10079         self.assertEqual(len(record.rounds[0].new_seqs), 27)
10080         self.assertEqual(record.rounds[0].new_seqs[0].title, "100K_RAT Q62671 rattus norvegicus (rat). 100 kda protein (ec...")
10081         self.assertEqual(record.rounds[0].new_seqs[0].score, 1516)
10082         self.assertAlmostEqual(record.rounds[0].new_seqs[0].e, 0.0)
10083         self.assertEqual(record.rounds[0].new_seqs[1].title, "HYDP_DROME P51592 drosophila melanogaster (fruit fly). hyper...")
10084         self.assertEqual(record.rounds[0].new_seqs[1].score, 513)
10085         self.assertAlmostEqual(record.rounds[0].new_seqs[1].e, 1e-145)
10086         self.assertEqual(record.rounds[0].new_seqs[2].title, "PUB1_SCHPO Q92462 schizosaccharomyces pombe (fission yeast)....")
10087         self.assertEqual(record.rounds[0].new_seqs[2].score, 95)
10088         self.assertAlmostEqual(record.rounds[0].new_seqs[2].e, 7e-19)
10089         self.assertEqual(record.rounds[0].new_seqs[3].title, "RSP5_YEAST P39940 saccharomyces cerevisiae (baker's yeast). ...")
10090         self.assertEqual(record.rounds[0].new_seqs[3].score, 93)
10091         self.assertAlmostEqual(record.rounds[0].new_seqs[3].e, 3e-18)
10092         self.assertEqual(record.rounds[0].new_seqs[4].title, "NED4_HUMAN P46934 homo sapiens (human). nedd-4 protein (ec 6...")
10093         self.assertEqual(record.rounds[0].new_seqs[4].score, 88)
10094         self.assertAlmostEqual(record.rounds[0].new_seqs[4].e, 9e-17)
10095         self.assertEqual(record.rounds[0].new_seqs[5].title, "NED4_MOUSE P46935 mus musculus (mouse). nedd-4 protein (ec 6...")
10096         self.assertEqual(record.rounds[0].new_seqs[5].score, 87)
10097         self.assertAlmostEqual(record.rounds[0].new_seqs[5].e, 9e-17)
10098         self.assertEqual(record.rounds[0].new_seqs[6].title, "URB1_RAT P51593 rattus norvegicus (rat). dna binding protein...")
10099         self.assertEqual(record.rounds[0].new_seqs[6].score, 85)
10100         self.assertAlmostEqual(record.rounds[0].new_seqs[6].e, 4e-16)
10101         self.assertEqual(record.rounds[0].new_seqs[7].title, "UE3A_HUMAN Q05086 homo sapiens (human). ubiquitin-protein li...")
10102         self.assertEqual(record.rounds[0].new_seqs[7].score, 84)
10103         self.assertAlmostEqual(record.rounds[0].new_seqs[7].e, 1e-15)
10104         self.assertEqual(record.rounds[0].new_seqs[8].title, "HUL5_YEAST P53119 saccharomyces cerevisiae (baker's yeast). ...")
10105         self.assertEqual(record.rounds[0].new_seqs[8].score, 83)
10106         self.assertAlmostEqual(record.rounds[0].new_seqs[8].e, 2e-15)
10107         self.assertEqual(record.rounds[0].new_seqs[9].title, "UE3A_MOUSE O08759 mus musculus (mouse). ubiquitin-protein li...")
10108         self.assertEqual(record.rounds[0].new_seqs[9].score, 82)
10109         self.assertAlmostEqual(record.rounds[0].new_seqs[9].e, 6e-15)
10110         self.assertEqual(record.rounds[0].new_seqs[10].title, "HUL4_YEAST P40985 saccharomyces cerevisiae (baker's yeast). ...")
10111         self.assertEqual(record.rounds[0].new_seqs[10].score, 69)
10112         self.assertAlmostEqual(record.rounds[0].new_seqs[10].e, 3e-11)
10113         self.assertEqual(record.rounds[0].new_seqs[11].title, "UFD4_YEAST P33202 saccharomyces cerevisiae (baker's yeast). ...")
10114         self.assertEqual(record.rounds[0].new_seqs[11].score, 58)
10115         self.assertAlmostEqual(record.rounds[0].new_seqs[11].e, 7e-8)
10116         self.assertEqual(record.rounds[0].new_seqs[12].title, "Y032_HUMAN Q15034 homo sapiens (human). hypothetical protein...")
10117         self.assertEqual(record.rounds[0].new_seqs[12].score, 56)
10118         self.assertAlmostEqual(record.rounds[0].new_seqs[12].e, 3e-7)
10119         self.assertEqual(record.rounds[0].new_seqs[13].title, "TR12_HUMAN Q14669 homo sapiens (human). thyroid receptor int...")
10120         self.assertEqual(record.rounds[0].new_seqs[13].score, 50)
10121         self.assertAlmostEqual(record.rounds[0].new_seqs[13].e, 0.00002)
10122         self.assertEqual(record.rounds[0].new_seqs[14].title, "PAB1_MOUSE P29341 mus musculus (mouse). polyadenylate-bindin...")
10123         self.assertEqual(record.rounds[0].new_seqs[14].score, 49)
10124         self.assertAlmostEqual(record.rounds[0].new_seqs[14].e, 0.00003)
10125         self.assertEqual(record.rounds[0].new_seqs[15].title, "PAB1_HUMAN P11940 homo sapiens (human). polyadenylate-bindin...")
10126         self.assertEqual(record.rounds[0].new_seqs[15].score, 49)
10127         self.assertAlmostEqual(record.rounds[0].new_seqs[15].e, 0.00005)
10128         self.assertEqual(record.rounds[0].new_seqs[16].title, "PABP_XENLA P20965 xenopus laevis (african clawed frog). poly...")
10129         self.assertEqual(record.rounds[0].new_seqs[16].score, 48)
10130         self.assertAlmostEqual(record.rounds[0].new_seqs[16].e, 0.00008)
10131         self.assertEqual(record.rounds[0].new_seqs[17].title, "PABP_DROME P21187 drosophila melanogaster (fruit fly). polya...")
10132         self.assertEqual(record.rounds[0].new_seqs[17].score, 41)
10133         self.assertAlmostEqual(record.rounds[0].new_seqs[17].e, 0.008)
10134         self.assertEqual(record.rounds[0].new_seqs[18].title, "PAB5_ARATH Q05196 arabidopsis thaliana (mouse-ear cress). po...")
10135         self.assertEqual(record.rounds[0].new_seqs[18].score, 37)
10136         self.assertAlmostEqual(record.rounds[0].new_seqs[18].e, 0.15)
10137         self.assertEqual(record.rounds[0].new_seqs[19].title, "PAB2_ARATH P42731 arabidopsis thaliana (mouse-ear cress). po...")
10138         self.assertEqual(record.rounds[0].new_seqs[19].score, 34)
10139         self.assertAlmostEqual(record.rounds[0].new_seqs[19].e, 0.99)
10140         self.assertEqual(record.rounds[0].new_seqs[20].title, "MCM3_MOUSE P25206 mus musculus (mouse). dna replication lice...")
10141         self.assertEqual(record.rounds[0].new_seqs[20].score, 34)
10142         self.assertAlmostEqual(record.rounds[0].new_seqs[20].e, 1.7)
10143         self.assertEqual(record.rounds[0].new_seqs[21].title, "PABP_SCHPO P31209 schizosaccharomyces pombe (fission yeast)....")
10144         self.assertEqual(record.rounds[0].new_seqs[21].score, 32)
10145         self.assertAlmostEqual(record.rounds[0].new_seqs[21].e, 3.8)
10146         self.assertEqual(record.rounds[0].new_seqs[22].title, "PROB_SERMA P17856 serratia marcescens. glutamate 5-kinase (e...")
10147         self.assertEqual(record.rounds[0].new_seqs[22].score, 32)
10148         self.assertAlmostEqual(record.rounds[0].new_seqs[22].e, 6.6)
10149         self.assertEqual(record.rounds[0].new_seqs[23].title, "ST20_CANAL Q92212 candida albicans (yeast). serine/threonine...")
10150         self.assertEqual(record.rounds[0].new_seqs[23].score, 31)
10151         self.assertAlmostEqual(record.rounds[0].new_seqs[23].e, 8.6)
10152         self.assertEqual(record.rounds[0].new_seqs[24].title, "KEND_HUMAN O95613 homo sapiens (human). kendrin (kiaa0402). ...")
10153         self.assertEqual(record.rounds[0].new_seqs[24].score, 31)
10154         self.assertAlmostEqual(record.rounds[0].new_seqs[24].e, 8.6)
10155         self.assertEqual(record.rounds[0].new_seqs[25].title, "FIXK_RHIME P13295 rhizobium meliloti (sinorhizobium meliloti...")
10156         self.assertEqual(record.rounds[0].new_seqs[25].score, 31)
10157         self.assertAlmostEqual(record.rounds[0].new_seqs[25].e, 8.6)
10158         self.assertEqual(record.rounds[0].new_seqs[26].title, "CC24_YEAST P11433 saccharomyces cerevisiae (baker's yeast). ...")
10159         self.assertEqual(record.rounds[0].new_seqs[26].score, 31)
10160         self.assertAlmostEqual(record.rounds[0].new_seqs[26].e, 8.6)
10161         self.assertEqual(len(record.rounds[0].alignments), 27)
10162         self.assertEqual(record.rounds[0].alignments[0].title, ">100K_RAT Q62671 rattus norvegicus (rat). 100 kda protein (ec 6.3.2.-). 7/1999")
10163         self.assertEqual(record.rounds[0].alignments[0].length, 889)
10164         self.assertEqual(record.rounds[0].alignments[1].title, ">HYDP_DROME P51592 drosophila melanogaster (fruit fly). hyperplastic discs protein (hyd protein) (ec 6.3.2.-). 12/1998")
10165         self.assertEqual(record.rounds[0].alignments[1].length, 2895)
10166         self.assertEqual(record.rounds[0].alignments[2].title, ">PUB1_SCHPO Q92462 schizosaccharomyces pombe (fission yeast). ubiquitin--protein ligase pub1 (ec 6.3.2.-). 12/1998")
10167         self.assertEqual(record.rounds[0].alignments[2].length, 767)
10168         self.assertEqual(record.rounds[0].alignments[3].title, ">RSP5_YEAST P39940 saccharomyces cerevisiae (baker's yeast). ubiquitin--protein ligase rsp5 (ec 6.3.2.-). 7/1999")
10169         self.assertEqual(record.rounds[0].alignments[3].length, 809)
10170         self.assertEqual(record.rounds[0].alignments[4].title, ">NED4_HUMAN P46934 homo sapiens (human). nedd-4 protein (ec 6.3.2.-) (kiaa0093) (fragment). 7/1999")
10171         self.assertEqual(record.rounds[0].alignments[4].length, 927)
10172         self.assertEqual(record.rounds[0].alignments[5].title, ">NED4_MOUSE P46935 mus musculus (mouse). nedd-4 protein (ec 6.3.2.-) (fragment). 11/1997")
10173         self.assertEqual(record.rounds[0].alignments[5].length, 957)
10174         self.assertEqual(record.rounds[0].alignments[6].title, ">URB1_RAT P51593 rattus norvegicus (rat). dna binding protein ure-b1 (ec 6.3.2.-). 10/1996")
10175         self.assertEqual(record.rounds[0].alignments[6].length, 310)
10176         self.assertEqual(record.rounds[0].alignments[7].title, ">UE3A_HUMAN Q05086 homo sapiens (human). ubiquitin-protein ligase e3a (ec 6.3.2.-) (oncogenic protein- associated protein e6-ap) (human papillomavirus e6-associated protein). 5/2000")
10177         self.assertEqual(record.rounds[0].alignments[7].length, 875)
10178         self.assertEqual(record.rounds[0].alignments[8].title, ">HUL5_YEAST P53119 saccharomyces cerevisiae (baker's yeast). probable ubiquitin--protein ligase hul5 (ec 6.3.2.-). 5/2000")
10179         self.assertEqual(record.rounds[0].alignments[8].length, 910)
10180         self.assertEqual(record.rounds[0].alignments[9].title, ">UE3A_MOUSE O08759 mus musculus (mouse). ubiquitin-protein ligase e3a (ec 6.3.2.-) (oncogenic protein- associated protein e6-ap). 5/2000")
10181         self.assertEqual(record.rounds[0].alignments[9].length, 885)
10182         self.assertEqual(record.rounds[0].alignments[10].title, ">HUL4_YEAST P40985 saccharomyces cerevisiae (baker's yeast). probable ubiquitin--protein ligase hul4 (ec 6.3.2.-). 5/2000")
10183         self.assertEqual(record.rounds[0].alignments[10].length, 892)
10184         self.assertEqual(record.rounds[0].alignments[11].title, ">UFD4_YEAST P33202 saccharomyces cerevisiae (baker's yeast). ubiquitin fusion degradation protein 4 (ub fusion protein 4). 11/1997")
10185         self.assertEqual(record.rounds[0].alignments[11].length, 1483)
10186         self.assertEqual(record.rounds[0].alignments[12].title, ">Y032_HUMAN Q15034 homo sapiens (human). hypothetical protein kiaa0032. 5/2000")
10187         self.assertEqual(record.rounds[0].alignments[12].length, 1050)
10188         self.assertEqual(record.rounds[0].alignments[13].title, ">TR12_HUMAN Q14669 homo sapiens (human). thyroid receptor interacting protein 12 (trip12) (kiaa0045). 12/1998")
10189         self.assertEqual(record.rounds[0].alignments[13].length, 1992)
10190         self.assertEqual(record.rounds[0].alignments[14].title, ">PAB1_MOUSE P29341 mus musculus (mouse). polyadenylate-binding protein 1 (poly(a) binding protein 1) (pabp 1). 7/1998")
10191         self.assertEqual(record.rounds[0].alignments[14].length, 636)
10192         self.assertEqual(record.rounds[0].alignments[15].title, ">PAB1_HUMAN P11940 homo sapiens (human). polyadenylate-binding protein 1 (poly(a) binding protein 1) (pabp 1). 7/1998")
10193         self.assertEqual(record.rounds[0].alignments[15].length, 636)
10194         self.assertEqual(record.rounds[0].alignments[16].title, ">PABP_XENLA P20965 xenopus laevis (african clawed frog). polyadenylate-binding protein (poly(a) binding protein) (pabp). 7/1998")
10195         self.assertEqual(record.rounds[0].alignments[16].length, 633)
10196         self.assertEqual(record.rounds[0].alignments[17].title, ">PABP_DROME P21187 drosophila melanogaster (fruit fly). polyadenylate-binding protein (poly(a) binding protein) (pabp). 2/1995")
10197         self.assertEqual(record.rounds[0].alignments[17].length, 632)
10198         self.assertEqual(record.rounds[0].alignments[18].title, ">PAB5_ARATH Q05196 arabidopsis thaliana (mouse-ear cress). polyadenylate-binding protein 5 (poly(a) binding protein 5) (pabp 5). 11/1995")
10199         self.assertEqual(record.rounds[0].alignments[18].length, 668)
10200         self.assertEqual(record.rounds[0].alignments[19].title, ">PAB2_ARATH P42731 arabidopsis thaliana (mouse-ear cress). polyadenylate-binding protein 2 (poly(a) binding protein 2) (pabp 2). 12/1998")
10201         self.assertEqual(record.rounds[0].alignments[19].length, 629)
10202         self.assertEqual(record.rounds[0].alignments[20].title, ">MCM3_MOUSE P25206 mus musculus (mouse). dna replication licensing factor mcm3 (dna polymerase alpha holoenzyme-associated protein p1) (p1-mcm3). 5/2000")
10203         self.assertEqual(record.rounds[0].alignments[20].length, 812)
10204         self.assertEqual(record.rounds[0].alignments[21].title, ">PABP_SCHPO P31209 schizosaccharomyces pombe (fission yeast). polyadenylate-binding protein (poly(a) binding protein) (pabp). 7/1998")
10205         self.assertEqual(record.rounds[0].alignments[21].length, 653)
10206         self.assertEqual(record.rounds[0].alignments[22].title, ">PROB_SERMA P17856 serratia marcescens. glutamate 5-kinase (ec 2.7.2.11) (gamma-glutamyl kinase) (gk). 10/1996")
10207         self.assertEqual(record.rounds[0].alignments[22].length, 367)
10208         self.assertEqual(record.rounds[0].alignments[23].title, ">ST20_CANAL Q92212 candida albicans (yeast). serine/threonine-protein kinase ste20 homolog (ec 2.7.1.-). 5/2000")
10209         self.assertEqual(record.rounds[0].alignments[23].length, 1230)
10210         self.assertEqual(record.rounds[0].alignments[24].title, ">KEND_HUMAN O95613 homo sapiens (human). kendrin (kiaa0402). 5/2000")
10211         self.assertEqual(record.rounds[0].alignments[24].length, 3321)
10212         self.assertEqual(record.rounds[0].alignments[25].title, ">FIXK_RHIME P13295 rhizobium meliloti (sinorhizobium meliloti). nitrogen fixation regulation protein fixk. 5/2000")
10213         self.assertEqual(record.rounds[0].alignments[25].length, 211)
10214         self.assertEqual(record.rounds[0].alignments[26].title, ">CC24_YEAST P11433 saccharomyces cerevisiae (baker's yeast). cell division control protein 24 (calcium regulatory protein). 7/1999")
10215         self.assertEqual(record.rounds[0].alignments[26].length, 854)

Here is the caller graph for this function:

def test_NCBITextParser.TestNCBITextParser._check_bt060_round1 (   self,
  record 
) [private]

Definition at line 10216 of file test_NCBITextParser.py.

10216 
10217     def _check_bt060_round1(self, record):
10218         self.assertEqual(len(record.rounds[1].new_seqs), 9)
10219         self.assertEqual(record.rounds[1].new_seqs[0].title, "PABP_DROME P21187 drosophila melanogaster (fruit fly). polya...")
10220         self.assertEqual(record.rounds[1].new_seqs[0].score, 67)
10221         self.assertAlmostEqual(record.rounds[1].new_seqs[0].e, 1e-10)
10222         self.assertEqual(record.rounds[1].new_seqs[1].title, "PABP_SCHPO P31209 schizosaccharomyces pombe (fission yeast)....")
10223         self.assertEqual(record.rounds[1].new_seqs[1].score, 44)
10224         self.assertAlmostEqual(record.rounds[1].new_seqs[1].e, 0.001)
10225         self.assertEqual(record.rounds[1].new_seqs[2].title, "PAB2_ARATH P42731 arabidopsis thaliana (mouse-ear cress). po...")
10226         self.assertEqual(record.rounds[1].new_seqs[2].score, 43)
10227         self.assertAlmostEqual(record.rounds[1].new_seqs[2].e, 0.003)
10228         self.assertEqual(record.rounds[1].new_seqs[3].title, "PAB5_ARATH Q05196 arabidopsis thaliana (mouse-ear cress). po...")
10229         self.assertEqual(record.rounds[1].new_seqs[3].score, 43)
10230         self.assertAlmostEqual(record.rounds[1].new_seqs[3].e, 0.003)
10231         self.assertEqual(record.rounds[1].new_seqs[4].title, "PABP_YEAST P04147 saccharomyces cerevisiae polyadenylate-bin...")
10232         self.assertEqual(record.rounds[1].new_seqs[4].score, 41)
10233         self.assertAlmostEqual(record.rounds[1].new_seqs[4].e, 0.01)
10234         self.assertEqual(record.rounds[1].new_seqs[5].title, "RNR_AQUAE O67834 aquifex aeolicus. ribonuclease r (ec 3.1.-....")
10235         self.assertEqual(record.rounds[1].new_seqs[5].score, 33)
10236         self.assertAlmostEqual(record.rounds[1].new_seqs[5].e, 2.2)
10237         self.assertEqual(record.rounds[1].new_seqs[6].title, "NIRA_EMENI P28348 emericella nidulans (aspergillus nidulans)...")
10238         self.assertEqual(record.rounds[1].new_seqs[6].score, 33)
10239         self.assertAlmostEqual(record.rounds[1].new_seqs[6].e, 2.9)
10240         self.assertEqual(record.rounds[1].new_seqs[7].title, "YK44_YEAST P36023 saccharomyces cerevisiae (baker's yeast). ...")
10241         self.assertEqual(record.rounds[1].new_seqs[7].score, 31)
10242         self.assertAlmostEqual(record.rounds[1].new_seqs[7].e, 8.4)
10243         self.assertEqual(record.rounds[1].new_seqs[8].title, "SYQ_YEAST P13188 saccharomyces cerevisiae (baker's yeast). g...")
10244         self.assertEqual(record.rounds[1].new_seqs[8].score, 31)
10245         self.assertAlmostEqual(record.rounds[1].new_seqs[8].e, 8.4)
10246         self.assertEqual(len(record.rounds[1].alignments), 26)
10247         self.assertEqual(record.rounds[1].alignments[0].title, ">100K_RAT Q62671 rattus norvegicus (rat). 100 kda protein (ec 6.3.2.-). 7/1999")
10248         self.assertEqual(record.rounds[1].alignments[0].length, 889)
10249         self.assertEqual(record.rounds[1].alignments[1].title, ">HYDP_DROME P51592 drosophila melanogaster (fruit fly). hyperplastic discs protein (hyd protein) (ec 6.3.2.-). 12/1998")
10250         self.assertEqual(record.rounds[1].alignments[1].length, 2895)
10251         self.assertEqual(record.rounds[1].alignments[2].title, ">NED4_HUMAN P46934 homo sapiens (human). nedd-4 protein (ec 6.3.2.-) (kiaa0093) (fragment). 7/1999")
10252         self.assertEqual(record.rounds[1].alignments[2].length, 927)
10253         self.assertEqual(record.rounds[1].alignments[3].title, ">PUB1_SCHPO Q92462 schizosaccharomyces pombe (fission yeast). ubiquitin--protein ligase pub1 (ec 6.3.2.-). 12/1998")
10254         self.assertEqual(record.rounds[1].alignments[3].length, 767)
10255         self.assertEqual(record.rounds[1].alignments[4].title, ">NED4_MOUSE P46935 mus musculus (mouse). nedd-4 protein (ec 6.3.2.-) (fragment). 11/1997")
10256         self.assertEqual(record.rounds[1].alignments[4].length, 957)
10257         self.assertEqual(record.rounds[1].alignments[5].title, ">RSP5_YEAST P39940 saccharomyces cerevisiae (baker's yeast). ubiquitin--protein ligase rsp5 (ec 6.3.2.-). 7/1999")
10258         self.assertEqual(record.rounds[1].alignments[5].length, 809)
10259         self.assertEqual(record.rounds[1].alignments[6].title, ">UE3A_HUMAN Q05086 homo sapiens (human). ubiquitin-protein ligase e3a (ec 6.3.2.-) (oncogenic protein- associated protein e6-ap) (human papillomavirus e6-associated protein). 5/2000")
10260         self.assertEqual(record.rounds[1].alignments[6].length, 875)
10261         self.assertEqual(record.rounds[1].alignments[7].title, ">UE3A_MOUSE O08759 mus musculus (mouse). ubiquitin-protein ligase e3a (ec 6.3.2.-) (oncogenic protein- associated protein e6-ap). 5/2000")
10262         self.assertEqual(record.rounds[1].alignments[7].length, 885)
10263         self.assertEqual(record.rounds[1].alignments[8].title, ">HUL4_YEAST P40985 saccharomyces cerevisiae (baker's yeast). probable ubiquitin--protein ligase hul4 (ec 6.3.2.-). 5/2000")
10264         self.assertEqual(record.rounds[1].alignments[8].length, 892)
10265         self.assertEqual(record.rounds[1].alignments[9].title, ">URB1_RAT P51593 rattus norvegicus (rat). dna binding protein ure-b1 (ec 6.3.2.-). 10/1996")
10266         self.assertEqual(record.rounds[1].alignments[9].length, 310)
10267         self.assertEqual(record.rounds[1].alignments[10].title, ">TR12_HUMAN Q14669 homo sapiens (human). thyroid receptor interacting protein 12 (trip12) (kiaa0045). 12/1998")
10268         self.assertEqual(record.rounds[1].alignments[10].length, 1992)
10269         self.assertEqual(record.rounds[1].alignments[11].title, ">Y032_HUMAN Q15034 homo sapiens (human). hypothetical protein kiaa0032. 5/2000")
10270         self.assertEqual(record.rounds[1].alignments[11].length, 1050)
10271         self.assertEqual(record.rounds[1].alignments[12].title, ">HUL5_YEAST P53119 saccharomyces cerevisiae (baker's yeast). probable ubiquitin--protein ligase hul5 (ec 6.3.2.-). 5/2000")
10272         self.assertEqual(record.rounds[1].alignments[12].length, 910)
10273         self.assertEqual(record.rounds[1].alignments[13].title, ">UFD4_YEAST P33202 saccharomyces cerevisiae (baker's yeast). ubiquitin fusion degradation protein 4 (ub fusion protein 4). 11/1997")
10274         self.assertEqual(record.rounds[1].alignments[13].length, 1483)
10275         self.assertEqual(record.rounds[1].alignments[14].title, ">PAB1_HUMAN P11940 homo sapiens (human). polyadenylate-binding protein 1 (poly(a) binding protein 1) (pabp 1). 7/1998")
10276         self.assertEqual(record.rounds[1].alignments[14].length, 636)
10277         self.assertEqual(record.rounds[1].alignments[15].title, ">PABP_XENLA P20965 xenopus laevis (african clawed frog). polyadenylate-binding protein (poly(a) binding protein) (pabp). 7/1998")
10278         self.assertEqual(record.rounds[1].alignments[15].length, 633)
10279         self.assertEqual(record.rounds[1].alignments[16].title, ">PAB1_MOUSE P29341 mus musculus (mouse). polyadenylate-binding protein 1 (poly(a) binding protein 1) (pabp 1). 7/1998")
10280         self.assertEqual(record.rounds[1].alignments[16].length, 636)
10281         self.assertEqual(record.rounds[1].alignments[17].title, ">PABP_DROME P21187 drosophila melanogaster (fruit fly). polyadenylate-binding protein (poly(a) binding protein) (pabp). 2/1995")
10282         self.assertEqual(record.rounds[1].alignments[17].length, 632)
10283         self.assertEqual(record.rounds[1].alignments[18].title, ">PABP_SCHPO P31209 schizosaccharomyces pombe (fission yeast). polyadenylate-binding protein (poly(a) binding protein) (pabp). 7/1998")
10284         self.assertEqual(record.rounds[1].alignments[18].length, 653)
10285         self.assertEqual(record.rounds[1].alignments[19].title, ">PAB2_ARATH P42731 arabidopsis thaliana (mouse-ear cress). polyadenylate-binding protein 2 (poly(a) binding protein 2) (pabp 2). 12/1998")
10286         self.assertEqual(record.rounds[1].alignments[19].length, 629)
10287         self.assertEqual(record.rounds[1].alignments[20].title, ">PAB5_ARATH Q05196 arabidopsis thaliana (mouse-ear cress). polyadenylate-binding protein 5 (poly(a) binding protein 5) (pabp 5). 11/1995")
10288         self.assertEqual(record.rounds[1].alignments[20].length, 668)
10289         self.assertEqual(record.rounds[1].alignments[21].title, ">PABP_YEAST P04147 saccharomyces cerevisiae polyadenylate-binding protein, cytoplasmic and nuclear (pabp) (ars consensus binding protein acbp-67) (polyadenylate tail-binding protein). 2/1996")
10290         self.assertEqual(record.rounds[1].alignments[21].length, 576)
10291         self.assertEqual(record.rounds[1].alignments[22].title, ">RNR_AQUAE O67834 aquifex aeolicus. ribonuclease r (ec 3.1.-.-) (rnase r) (vacb protein homolog). 5/2000")
10292         self.assertEqual(record.rounds[1].alignments[22].length, 705)
10293         self.assertEqual(record.rounds[1].alignments[23].title, ">NIRA_EMENI P28348 emericella nidulans (aspergillus nidulans). nitrogen assimilation transcription factor nira. 4/1993")
10294         self.assertEqual(record.rounds[1].alignments[23].length, 892)
10295         self.assertEqual(record.rounds[1].alignments[24].title, ">YK44_YEAST P36023 saccharomyces cerevisiae (baker's yeast). putative 101.8 kda transcriptional regulatory protein in las1-ccp1 intergenic region. 2/1995")
10296         self.assertEqual(record.rounds[1].alignments[24].length, 863)
10297         self.assertEqual(record.rounds[1].alignments[25].title, ">SYQ_YEAST P13188 saccharomyces cerevisiae (baker's yeast). glutaminyl-trna synthetase (ec 6.1.1.18) (glutamine--trna ligase) (glnrs). 11/1997")
10298         self.assertEqual(record.rounds[1].alignments[25].length, 809)

Here is the caller graph for this function:

def test_NCBITextParser.TestNCBITextParser._check_bt060_round2 (   self,
  record 
) [private]

Definition at line 10299 of file test_NCBITextParser.py.

10299 
10300     def _check_bt060_round2(self, record):
10301         self.assertEqual(len(record.rounds[2].new_seqs), 6)
10302         self.assertEqual(record.rounds[2].new_seqs[0].title, "PAB2_ARATH P42731 arabidopsis thaliana (mouse-ear cress). po...")
10303         self.assertEqual(record.rounds[2].new_seqs[0].score, 48)
10304         self.assertAlmostEqual(record.rounds[2].new_seqs[0].e, 1e-4)
10305         self.assertEqual(record.rounds[2].new_seqs[1].title, "PABP_SCHPO P31209 schizosaccharomyces pombe (fission yeast)....")
10306         self.assertEqual(record.rounds[2].new_seqs[1].score, 45)
10307         self.assertAlmostEqual(record.rounds[2].new_seqs[1].e, 7e-4)
10308         self.assertEqual(record.rounds[2].new_seqs[2].title, "PAB5_ARATH Q05196 arabidopsis thaliana (mouse-ear cress). po...")
10309         self.assertEqual(record.rounds[2].new_seqs[2].score, 44)
10310         self.assertAlmostEqual(record.rounds[2].new_seqs[2].e, 0.001)
10311         self.assertEqual(record.rounds[2].new_seqs[3].title, "PABP_YEAST P04147 saccharomyces cerevisiae polyadenylate-bin...")
10312         self.assertEqual(record.rounds[2].new_seqs[3].score, 42)
10313         self.assertAlmostEqual(record.rounds[2].new_seqs[3].e, 0.006)
10314         self.assertEqual(record.rounds[2].new_seqs[4].title, "NIRA_EMENI P28348 emericella nidulans (aspergillus nidulans)...")
10315         self.assertEqual(record.rounds[2].new_seqs[4].score, 33)
10316         self.assertAlmostEqual(record.rounds[2].new_seqs[4].e, 2.9)
10317         self.assertEqual(record.rounds[2].new_seqs[5].title, "RNR_AQUAE O67834 aquifex aeolicus. ribonuclease r (ec 3.1.-....")
10318         self.assertEqual(record.rounds[2].new_seqs[5].score, 32)
10319         self.assertAlmostEqual(record.rounds[2].new_seqs[5].e, 3.7)
10320         self.assertEqual(len(record.rounds[2].alignments), 24)
10321         self.assertEqual(record.rounds[2].alignments[0].title, ">100K_RAT Q62671 rattus norvegicus (rat). 100 kda protein (ec 6.3.2.-). 7/1999")
10322         self.assertEqual(record.rounds[2].alignments[0].length, 889)
10323         self.assertEqual(record.rounds[2].alignments[1].title, ">HYDP_DROME P51592 drosophila melanogaster (fruit fly). hyperplastic discs protein (hyd protein) (ec 6.3.2.-). 12/1998")
10324         self.assertEqual(record.rounds[2].alignments[1].length, 2895)
10325         self.assertEqual(record.rounds[2].alignments[2].title, ">PUB1_SCHPO Q92462 schizosaccharomyces pombe (fission yeast). ubiquitin--protein ligase pub1 (ec 6.3.2.-). 12/1998")
10326         self.assertEqual(record.rounds[2].alignments[2].length, 767)
10327         self.assertEqual(record.rounds[2].alignments[3].title, ">NED4_HUMAN P46934 homo sapiens (human). nedd-4 protein (ec 6.3.2.-) (kiaa0093) (fragment). 7/1999")
10328         self.assertEqual(record.rounds[2].alignments[3].length, 927)
10329         self.assertEqual(record.rounds[2].alignments[4].title, ">NED4_MOUSE P46935 mus musculus (mouse). nedd-4 protein (ec 6.3.2.-) (fragment). 11/1997")
10330         self.assertEqual(record.rounds[2].alignments[4].length, 957)
10331         self.assertEqual(record.rounds[2].alignments[5].title, ">RSP5_YEAST P39940 saccharomyces cerevisiae (baker's yeast). ubiquitin--protein ligase rsp5 (ec 6.3.2.-). 7/1999")
10332         self.assertEqual(record.rounds[2].alignments[5].length, 809)
10333         self.assertEqual(record.rounds[2].alignments[6].title, ">UE3A_HUMAN Q05086 homo sapiens (human). ubiquitin-protein ligase e3a (ec 6.3.2.-) (oncogenic protein- associated protein e6-ap) (human papillomavirus e6-associated protein). 5/2000")
10334         self.assertEqual(record.rounds[2].alignments[6].length, 875)
10335         self.assertEqual(record.rounds[2].alignments[7].title, ">UE3A_MOUSE O08759 mus musculus (mouse). ubiquitin-protein ligase e3a (ec 6.3.2.-) (oncogenic protein- associated protein e6-ap). 5/2000")
10336         self.assertEqual(record.rounds[2].alignments[7].length, 885)
10337         self.assertEqual(record.rounds[2].alignments[8].title, ">HUL4_YEAST P40985 saccharomyces cerevisiae (baker's yeast). probable ubiquitin--protein ligase hul4 (ec 6.3.2.-). 5/2000")
10338         self.assertEqual(record.rounds[2].alignments[8].length, 892)
10339         self.assertEqual(record.rounds[2].alignments[9].title, ">TR12_HUMAN Q14669 homo sapiens (human). thyroid receptor interacting protein 12 (trip12) (kiaa0045). 12/1998")
10340         self.assertEqual(record.rounds[2].alignments[9].length, 1992)
10341         self.assertEqual(record.rounds[2].alignments[10].title, ">URB1_RAT P51593 rattus norvegicus (rat). dna binding protein ure-b1 (ec 6.3.2.-). 10/1996")
10342         self.assertEqual(record.rounds[2].alignments[10].length, 310)
10343         self.assertEqual(record.rounds[2].alignments[11].title, ">Y032_HUMAN Q15034 homo sapiens (human). hypothetical protein kiaa0032. 5/2000")
10344         self.assertEqual(record.rounds[2].alignments[11].length, 1050)
10345         self.assertEqual(record.rounds[2].alignments[12].title, ">UFD4_YEAST P33202 saccharomyces cerevisiae (baker's yeast). ubiquitin fusion degradation protein 4 (ub fusion protein 4). 11/1997")
10346         self.assertEqual(record.rounds[2].alignments[12].length, 1483)
10347         self.assertEqual(record.rounds[2].alignments[13].title, ">HUL5_YEAST P53119 saccharomyces cerevisiae (baker's yeast). probable ubiquitin--protein ligase hul5 (ec 6.3.2.-). 5/2000")
10348         self.assertEqual(record.rounds[2].alignments[13].length, 910)
10349         self.assertEqual(record.rounds[2].alignments[14].title, ">PABP_DROME P21187 drosophila melanogaster (fruit fly). polyadenylate-binding protein (poly(a) binding protein) (pabp). 2/1995")
10350         self.assertEqual(record.rounds[2].alignments[14].length, 632)
10351         self.assertEqual(record.rounds[2].alignments[15].title, ">PAB1_HUMAN P11940 homo sapiens (human). polyadenylate-binding protein 1 (poly(a) binding protein 1) (pabp 1). 7/1998")
10352         self.assertEqual(record.rounds[2].alignments[15].length, 636)
10353         self.assertEqual(record.rounds[2].alignments[16].title, ">PABP_XENLA P20965 xenopus laevis (african clawed frog). polyadenylate-binding protein (poly(a) binding protein) (pabp). 7/1998")
10354         self.assertEqual(record.rounds[2].alignments[16].length, 633)
10355         self.assertEqual(record.rounds[2].alignments[17].title, ">PAB1_MOUSE P29341 mus musculus (mouse). polyadenylate-binding protein 1 (poly(a) binding protein 1) (pabp 1). 7/1998")
10356         self.assertEqual(record.rounds[2].alignments[17].length, 636)
10357         self.assertEqual(record.rounds[2].alignments[18].title, ">PAB2_ARATH P42731 arabidopsis thaliana (mouse-ear cress). polyadenylate-binding protein 2 (poly(a) binding protein 2) (pabp 2). 12/1998")
10358         self.assertEqual(record.rounds[2].alignments[18].length, 629)
10359         self.assertEqual(record.rounds[2].alignments[19].title, ">PABP_SCHPO P31209 schizosaccharomyces pombe (fission yeast). polyadenylate-binding protein (poly(a) binding protein) (pabp). 7/1998")
10360         self.assertEqual(record.rounds[2].alignments[19].length, 653)
10361         self.assertEqual(record.rounds[2].alignments[20].title, ">PAB5_ARATH Q05196 arabidopsis thaliana (mouse-ear cress). polyadenylate-binding protein 5 (poly(a) binding protein 5) (pabp 5). 11/1995")
10362         self.assertEqual(record.rounds[2].alignments[20].length, 668)
10363         self.assertEqual(record.rounds[2].alignments[21].title, ">PABP_YEAST P04147 saccharomyces cerevisiae polyadenylate-binding protein, cytoplasmic and nuclear (pabp) (ars consensus binding protein acbp-67) (polyadenylate tail-binding protein). 2/1996")
10364         self.assertEqual(record.rounds[2].alignments[21].length, 576)
10365         self.assertEqual(record.rounds[2].alignments[22].title, ">NIRA_EMENI P28348 emericella nidulans (aspergillus nidulans). nitrogen assimilation transcription factor nira. 4/1993")
10366         self.assertEqual(record.rounds[2].alignments[22].length, 892)
10367         self.assertEqual(record.rounds[2].alignments[23].title, ">RNR_AQUAE O67834 aquifex aeolicus. ribonuclease r (ec 3.1.-.-) (rnase r) (vacb protein homolog). 5/2000")
10368         self.assertEqual(record.rounds[2].alignments[23].length, 705)

Here is the caller graph for this function:

def test_NCBITextParser.TestNCBITextParser._check_bt060_round3 (   self,
  record 
) [private]

Definition at line 10369 of file test_NCBITextParser.py.

10369 
10370     def _check_bt060_round3(self, record):
10371         self.assertEqual(len(record.rounds[3].new_seqs), 4)
10372         self.assertEqual(record.rounds[3].new_seqs[0].title, "PAB5_ARATH Q05196 arabidopsis thaliana (mouse-ear cress). po...")
10373         self.assertEqual(record.rounds[3].new_seqs[0].score, 51)
10374         self.assertAlmostEqual(record.rounds[3].new_seqs[0].e, 9e-6)
10375         self.assertEqual(record.rounds[3].new_seqs[1].title, "PABP_YEAST P04147 saccharomyces cerevisiae polyadenylate-bin...")
10376         self.assertEqual(record.rounds[3].new_seqs[1].score, 45)
10377         self.assertAlmostEqual(record.rounds[3].new_seqs[1].e, 5e-4)
10378         self.assertEqual(record.rounds[3].new_seqs[2].title, "RNR_AQUAE O67834 aquifex aeolicus. ribonuclease r (ec 3.1.-....")
10379         self.assertEqual(record.rounds[3].new_seqs[2].score, 33)
10380         self.assertAlmostEqual(record.rounds[3].new_seqs[2].e, 2.9)
10381         self.assertEqual(record.rounds[3].new_seqs[3].title, "NIRA_EMENI P28348 emericella nidulans (aspergillus nidulans)...")
10382         self.assertEqual(record.rounds[3].new_seqs[3].score, 33)
10383         self.assertAlmostEqual(record.rounds[3].new_seqs[3].e, 2.9)
10384         self.assertEqual(len(record.rounds[3].alignments), 24)
10385         self.assertEqual(record.rounds[3].alignments[0].title, ">100K_RAT Q62671 rattus norvegicus (rat). 100 kda protein (ec 6.3.2.-). 7/1999")
10386         self.assertEqual(record.rounds[3].alignments[0].length, 889)
10387         self.assertEqual(record.rounds[3].alignments[1].title, ">HYDP_DROME P51592 drosophila melanogaster (fruit fly). hyperplastic discs protein (hyd protein) (ec 6.3.2.-). 12/1998")
10388         self.assertEqual(record.rounds[3].alignments[1].length, 2895)
10389         self.assertEqual(record.rounds[3].alignments[2].title, ">PUB1_SCHPO Q92462 schizosaccharomyces pombe (fission yeast). ubiquitin--protein ligase pub1 (ec 6.3.2.-). 12/1998")
10390         self.assertEqual(record.rounds[3].alignments[2].length, 767)
10391         self.assertEqual(record.rounds[3].alignments[3].title, ">NED4_HUMAN P46934 homo sapiens (human). nedd-4 protein (ec 6.3.2.-) (kiaa0093) (fragment). 7/1999")
10392         self.assertEqual(record.rounds[3].alignments[3].length, 927)
10393         self.assertEqual(record.rounds[3].alignments[4].title, ">NED4_MOUSE P46935 mus musculus (mouse). nedd-4 protein (ec 6.3.2.-) (fragment). 11/1997")
10394         self.assertEqual(record.rounds[3].alignments[4].length, 957)
10395         self.assertEqual(record.rounds[3].alignments[5].title, ">RSP5_YEAST P39940 saccharomyces cerevisiae (baker's yeast). ubiquitin--protein ligase rsp5 (ec 6.3.2.-). 7/1999")
10396         self.assertEqual(record.rounds[3].alignments[5].length, 809)
10397         self.assertEqual(record.rounds[3].alignments[6].title, ">UE3A_HUMAN Q05086 homo sapiens (human). ubiquitin-protein ligase e3a (ec 6.3.2.-) (oncogenic protein- associated protein e6-ap) (human papillomavirus e6-associated protein). 5/2000")
10398         self.assertEqual(record.rounds[3].alignments[6].length, 875)
10399         self.assertEqual(record.rounds[3].alignments[7].title, ">UE3A_MOUSE O08759 mus musculus (mouse). ubiquitin-protein ligase e3a (ec 6.3.2.-) (oncogenic protein- associated protein e6-ap). 5/2000")
10400         self.assertEqual(record.rounds[3].alignments[7].length, 885)
10401         self.assertEqual(record.rounds[3].alignments[8].title, ">HUL4_YEAST P40985 saccharomyces cerevisiae (baker's yeast). probable ubiquitin--protein ligase hul4 (ec 6.3.2.-). 5/2000")
10402         self.assertEqual(record.rounds[3].alignments[8].length, 892)
10403         self.assertEqual(record.rounds[3].alignments[9].title, ">TR12_HUMAN Q14669 homo sapiens (human). thyroid receptor interacting protein 12 (trip12) (kiaa0045). 12/1998")
10404         self.assertEqual(record.rounds[3].alignments[9].length, 1992)
10405         self.assertEqual(record.rounds[3].alignments[10].title, ">URB1_RAT P51593 rattus norvegicus (rat). dna binding protein ure-b1 (ec 6.3.2.-). 10/1996")
10406         self.assertEqual(record.rounds[3].alignments[10].length, 310)
10407         self.assertEqual(record.rounds[3].alignments[11].title, ">Y032_HUMAN Q15034 homo sapiens (human). hypothetical protein kiaa0032. 5/2000")
10408         self.assertEqual(record.rounds[3].alignments[11].length, 1050)
10409         self.assertEqual(record.rounds[3].alignments[12].title, ">UFD4_YEAST P33202 saccharomyces cerevisiae (baker's yeast). ubiquitin fusion degradation protein 4 (ub fusion protein 4). 11/1997")
10410         self.assertEqual(record.rounds[3].alignments[12].length, 1483)
10411         self.assertEqual(record.rounds[3].alignments[13].title, ">HUL5_YEAST P53119 saccharomyces cerevisiae (baker's yeast). probable ubiquitin--protein ligase hul5 (ec 6.3.2.-). 5/2000")
10412         self.assertEqual(record.rounds[3].alignments[13].length, 910)
10413         self.assertEqual(record.rounds[3].alignments[14].title, ">PAB1_HUMAN P11940 homo sapiens (human). polyadenylate-binding protein 1 (poly(a) binding protein 1) (pabp 1). 7/1998")
10414         self.assertEqual(record.rounds[3].alignments[14].length, 636)
10415         self.assertEqual(record.rounds[3].alignments[15].title, ">PABP_DROME P21187 drosophila melanogaster (fruit fly). polyadenylate-binding protein (poly(a) binding protein) (pabp). 2/1995")
10416         self.assertEqual(record.rounds[3].alignments[15].length, 632)
10417         self.assertEqual(record.rounds[3].alignments[16].title, ">PABP_XENLA P20965 xenopus laevis (african clawed frog). polyadenylate-binding protein (poly(a) binding protein) (pabp). 7/1998")
10418         self.assertEqual(record.rounds[3].alignments[16].length, 633)
10419         self.assertEqual(record.rounds[3].alignments[17].title, ">PAB1_MOUSE P29341 mus musculus (mouse). polyadenylate-binding protein 1 (poly(a) binding protein 1) (pabp 1). 7/1998")
10420         self.assertEqual(record.rounds[3].alignments[17].length, 636)
10421         self.assertEqual(record.rounds[3].alignments[18].title, ">PABP_SCHPO P31209 schizosaccharomyces pombe (fission yeast). polyadenylate-binding protein (poly(a) binding protein) (pabp). 7/1998")
10422         self.assertEqual(record.rounds[3].alignments[18].length, 653)
10423         self.assertEqual(record.rounds[3].alignments[19].title, ">PAB2_ARATH P42731 arabidopsis thaliana (mouse-ear cress). polyadenylate-binding protein 2 (poly(a) binding protein 2) (pabp 2). 12/1998")
10424         self.assertEqual(record.rounds[3].alignments[19].length, 629)
10425         self.assertEqual(record.rounds[3].alignments[20].title, ">PAB5_ARATH Q05196 arabidopsis thaliana (mouse-ear cress). polyadenylate-binding protein 5 (poly(a) binding protein 5) (pabp 5). 11/1995")
10426         self.assertEqual(record.rounds[3].alignments[20].length, 668)
10427         self.assertEqual(record.rounds[3].alignments[21].title, ">PABP_YEAST P04147 saccharomyces cerevisiae polyadenylate-binding protein, cytoplasmic and nuclear (pabp) (ars consensus binding protein acbp-67) (polyadenylate tail-binding protein). 2/1996")
10428         self.assertEqual(record.rounds[3].alignments[21].length, 576)
10429         self.assertEqual(record.rounds[3].alignments[22].title, ">RNR_AQUAE O67834 aquifex aeolicus. ribonuclease r (ec 3.1.-.-) (rnase r) (vacb protein homolog). 5/2000")
10430         self.assertEqual(record.rounds[3].alignments[22].length, 705)
10431         self.assertEqual(record.rounds[3].alignments[23].title, ">NIRA_EMENI P28348 emericella nidulans (aspergillus nidulans). nitrogen assimilation transcription factor nira. 4/1993")
10432         self.assertEqual(record.rounds[3].alignments[23].length, 892)

def test_NCBITextParser.TestNCBITextParser._check_bt060_round4 (   self,
  record 
) [private]

Definition at line 10433 of file test_NCBITextParser.py.

10433 
10434     def _check_bt060_round4(self, record):
10435         self.assertEqual(len(record.rounds[4].new_seqs), 2)
10436         self.assertEqual(record.rounds[4].new_seqs[0].title, "RNR_AQUAE O67834 aquifex aeolicus. ribonuclease r (ec 3.1.-....")
10437         self.assertEqual(record.rounds[4].new_seqs[0].score, 33)
10438         self.assertAlmostEqual(record.rounds[4].new_seqs[0].e, 2.2)
10439         self.assertEqual(record.rounds[4].new_seqs[1].title, "NIRA_EMENI P28348 emericella nidulans (aspergillus nidulans)...")
10440         self.assertEqual(record.rounds[4].new_seqs[1].score, 33)
10441         self.assertAlmostEqual(record.rounds[4].new_seqs[1].e, 2.9)
10442         self.assertEqual(len(record.rounds[4].alignments), 24)
10443         self.assertEqual(record.rounds[4].alignments[0].title, ">100K_RAT Q62671 rattus norvegicus (rat). 100 kda protein (ec 6.3.2.-). 7/1999")
10444         self.assertEqual(record.rounds[4].alignments[0].length, 889)
10445         self.assertEqual(record.rounds[4].alignments[1].title, ">HYDP_DROME P51592 drosophila melanogaster (fruit fly). hyperplastic discs protein (hyd protein) (ec 6.3.2.-). 12/1998")
10446         self.assertEqual(record.rounds[4].alignments[1].length, 2895)
10447         self.assertEqual(record.rounds[4].alignments[2].title, ">PUB1_SCHPO Q92462 schizosaccharomyces pombe (fission yeast). ubiquitin--protein ligase pub1 (ec 6.3.2.-). 12/1998")
10448         self.assertEqual(record.rounds[4].alignments[2].length, 767)
10449         self.assertEqual(record.rounds[4].alignments[3].title, ">NED4_HUMAN P46934 homo sapiens (human). nedd-4 protein (ec 6.3.2.-) (kiaa0093) (fragment). 7/1999")
10450         self.assertEqual(record.rounds[4].alignments[3].length, 927)
10451         self.assertEqual(record.rounds[4].alignments[4].title, ">NED4_MOUSE P46935 mus musculus (mouse). nedd-4 protein (ec 6.3.2.-) (fragment). 11/1997")
10452         self.assertEqual(record.rounds[4].alignments[4].length, 957)
10453         self.assertEqual(record.rounds[4].alignments[5].title, ">RSP5_YEAST P39940 saccharomyces cerevisiae (baker's yeast). ubiquitin--protein ligase rsp5 (ec 6.3.2.-). 7/1999")
10454         self.assertEqual(record.rounds[4].alignments[5].length, 809)
10455         self.assertEqual(record.rounds[4].alignments[6].title, ">UE3A_HUMAN Q05086 homo sapiens (human). ubiquitin-protein ligase e3a (ec 6.3.2.-) (oncogenic protein- associated protein e6-ap) (human papillomavirus e6-associated protein). 5/2000")
10456         self.assertEqual(record.rounds[4].alignments[6].length, 875)
10457         self.assertEqual(record.rounds[4].alignments[7].title, ">UE3A_MOUSE O08759 mus musculus (mouse). ubiquitin-protein ligase e3a (ec 6.3.2.-) (oncogenic protein- associated protein e6-ap). 5/2000")
10458         self.assertEqual(record.rounds[4].alignments[7].length, 885)
10459         self.assertEqual(record.rounds[4].alignments[8].title, ">HUL4_YEAST P40985 saccharomyces cerevisiae (baker's yeast). probable ubiquitin--protein ligase hul4 (ec 6.3.2.-). 5/2000")
10460         self.assertEqual(record.rounds[4].alignments[8].length, 892)
10461         self.assertEqual(record.rounds[4].alignments[9].title, ">TR12_HUMAN Q14669 homo sapiens (human). thyroid receptor interacting protein 12 (trip12) (kiaa0045). 12/1998")
10462         self.assertEqual(record.rounds[4].alignments[9].length, 1992)
10463         self.assertEqual(record.rounds[4].alignments[10].title, ">URB1_RAT P51593 rattus norvegicus (rat). dna binding protein ure-b1 (ec 6.3.2.-). 10/1996")
10464         self.assertEqual(record.rounds[4].alignments[10].length, 310)
10465         self.assertEqual(record.rounds[4].alignments[11].title, ">Y032_HUMAN Q15034 homo sapiens (human). hypothetical protein kiaa0032. 5/2000")
10466         self.assertEqual(record.rounds[4].alignments[11].length, 1050)
10467         self.assertEqual(record.rounds[4].alignments[12].title, ">UFD4_YEAST P33202 saccharomyces cerevisiae (baker's yeast). ubiquitin fusion degradation protein 4 (ub fusion protein 4). 11/1997")
10468         self.assertEqual(record.rounds[4].alignments[12].length, 1483)
10469         self.assertEqual(record.rounds[4].alignments[13].title, ">HUL5_YEAST P53119 saccharomyces cerevisiae (baker's yeast). probable ubiquitin--protein ligase hul5 (ec 6.3.2.-). 5/2000")
10470         self.assertEqual(record.rounds[4].alignments[13].length, 910)
10471         self.assertEqual(record.rounds[4].alignments[14].title, ">PABP_DROME P21187 drosophila melanogaster (fruit fly). polyadenylate-binding protein (poly(a) binding protein) (pabp). 2/1995")
10472         self.assertEqual(record.rounds[4].alignments[14].length, 632)
10473         self.assertEqual(record.rounds[4].alignments[15].title, ">PAB1_HUMAN P11940 homo sapiens (human). polyadenylate-binding protein 1 (poly(a) binding protein 1) (pabp 1). 7/1998")
10474         self.assertEqual(record.rounds[4].alignments[15].length, 636)
10475         self.assertEqual(record.rounds[4].alignments[16].title, ">PAB1_MOUSE P29341 mus musculus (mouse). polyadenylate-binding protein 1 (poly(a) binding protein 1) (pabp 1). 7/1998")
10476         self.assertEqual(record.rounds[4].alignments[16].length, 636)
10477         self.assertEqual(record.rounds[4].alignments[17].title, ">PABP_XENLA P20965 xenopus laevis (african clawed frog). polyadenylate-binding protein (poly(a) binding protein) (pabp). 7/1998")
10478         self.assertEqual(record.rounds[4].alignments[17].length, 633)
10479         self.assertEqual(record.rounds[4].alignments[18].title, ">PABP_SCHPO P31209 schizosaccharomyces pombe (fission yeast). polyadenylate-binding protein (poly(a) binding protein) (pabp). 7/1998")
10480         self.assertEqual(record.rounds[4].alignments[18].length, 653)
10481         self.assertEqual(record.rounds[4].alignments[19].title, ">PAB2_ARATH P42731 arabidopsis thaliana (mouse-ear cress). polyadenylate-binding protein 2 (poly(a) binding protein 2) (pabp 2). 12/1998")
10482         self.assertEqual(record.rounds[4].alignments[19].length, 629)
10483         self.assertEqual(record.rounds[4].alignments[20].title, ">PAB5_ARATH Q05196 arabidopsis thaliana (mouse-ear cress). polyadenylate-binding protein 5 (poly(a) binding protein 5) (pabp 5). 11/1995")
10484         self.assertEqual(record.rounds[4].alignments[20].length, 668)
10485         self.assertEqual(record.rounds[4].alignments[21].title, ">PABP_YEAST P04147 saccharomyces cerevisiae polyadenylate-binding protein, cytoplasmic and nuclear (pabp) (ars consensus binding protein acbp-67) (polyadenylate tail-binding protein). 2/1996")
10486         self.assertEqual(record.rounds[4].alignments[21].length, 576)
10487         self.assertEqual(record.rounds[4].alignments[22].title, ">RNR_AQUAE O67834 aquifex aeolicus. ribonuclease r (ec 3.1.-.-) (rnase r) (vacb protein homolog). 5/2000")
10488         self.assertEqual(record.rounds[4].alignments[22].length, 705)
10489         self.assertEqual(record.rounds[4].alignments[23].title, ">NIRA_EMENI P28348 emericella nidulans (aspergillus nidulans). nitrogen assimilation transcription factor nira. 4/1993")
10490         self.assertEqual(record.rounds[4].alignments[23].length, 892)

Here is the caller graph for this function:

Definition at line 38 of file test_NCBITextParser.py.

00038 
00039     def setUp(self):
00040         self.parser = NCBIStandalone.BlastParser()
00041         self.pb_parser = NCBIStandalone.PSIBlastParser()

Definition at line 42 of file test_NCBITextParser.py.

00042 
00043     def test_bt001(self):
00044         "Test parsing BLASTP 2.0.10 output (bt001)"
00045 
00046         path = os.path.join('Blast', 'bt001.txt')
00047         handle = open(path)
00048         record = self.parser.parse(handle)
00049         handle.close()
00050         self.assertEqual(record.application, "BLASTP")
00051         self.assertEqual(record.version, '2.0.10')
00052         self.assertEqual(record.date, "Aug-26-1999")
00053         self.assertEqual(record.reference, TestNCBITextParser.reference)
00054         self.assertEqual(record.query, "gi|120291|sp|P21297|FLBT_CAUCR FLBT PROTEIN")
00055         self.assertEqual(record.query_letters, 141)
00056         self.assertEqual(record.database, "data/swissprot")
00057         self.assertEqual(record.database_sequences, 82258)
00058         self.assertEqual(record.database_letters, 29652561)
00059         self.assertEqual(len(record.descriptions), 3)
00060         self.assertEqual(record.descriptions[0].title, "gi|120291|sp|P21297|FLBT_CAUCR FLBT PROTEIN")
00061         self.assertEqual(record.descriptions[0].score, 284)
00062         self.assertAlmostEqual(record.descriptions[0].e, 7.e-77)
00063         self.assertEqual(record.descriptions[1].title, "gi|3024946|sp|Q58368|Y958_METJA HYPOTHETICAL PROTEIN MJ0958 PRE...")
00064         self.assertEqual(record.descriptions[1].score, 29)
00065         self.assertAlmostEqual(record.descriptions[1].e, 3.4)
00066         self.assertEqual(record.descriptions[2].title, "gi|3024745|sp|O26320|THSA_METTH PROBABLE THERMOSOME SUBUNIT A")
00067         self.assertEqual(record.descriptions[2].score, 29)
00068         self.assertAlmostEqual(record.descriptions[2].e, 4.5)
00069         self.assertEqual(len(record.alignments), 3)
00070         self.assertEqual(record.alignments[0].title, ">gi|120291|sp|P21297|FLBT_CAUCR FLBT PROTEIN")
00071         self.assertEqual(record.alignments[0].length, 141)
00072         self.assertEqual(record.alignments[1].title, ">gi|3024946|sp|Q58368|Y958_METJA HYPOTHETICAL PROTEIN MJ0958 PRECURSOR")
00073         self.assertEqual(record.alignments[1].length, 426)
00074         self.assertEqual(record.alignments[2].title, ">gi|3024745|sp|O26320|THSA_METTH PROBABLE THERMOSOME SUBUNIT A")
00075         self.assertEqual(record.alignments[2].length, 542)
00076         self.assertEqual(record.alignments[0].hsps[0].score, 718)
00077         self.assertAlmostEqual(record.alignments[0].hsps[0].bits, 284)
00078         self.assertAlmostEqual(record.alignments[0].hsps[0].expect, 7e-77)
00079         self.assertEqual(record.alignments[0].hsps[0].identities, (141, 141))
00080         self.assertEqual(record.alignments[0].hsps[0].positives, (141, 141))
00081         self.assertEqual(len(record.alignments[0].hsps), 1)
00082         self.assertEqual(record.alignments[1].hsps[0].score, 64)
00083         self.assertAlmostEqual(record.alignments[1].hsps[0].bits, 29.3)
00084         self.assertAlmostEqual(record.alignments[1].hsps[0].expect, 3.4)
00085         self.assertEqual(record.alignments[1].hsps[0].identities, (15, 47))
00086         self.assertEqual(record.alignments[1].hsps[0].positives, (23, 47))
00087         self.assertEqual(len(record.alignments[1].hsps), 1)
00088         self.assertEqual(record.alignments[2].hsps[0].score, 63)
00089         self.assertAlmostEqual(record.alignments[2].hsps[0].bits, 29.0)
00090         self.assertAlmostEqual(record.alignments[2].hsps[0].expect, 4.5)
00091         self.assertEqual(record.alignments[2].hsps[0].identities, (31, 107))
00092         self.assertEqual(record.alignments[2].hsps[0].positives, (46, 107))
00093         self.assertEqual(record.alignments[2].hsps[0].gaps, (9, 107))
00094         self.assertEqual(len(record.alignments[2].hsps), 1)
00095         self.assertEqual(record.alignments[0].hsps[0].query, "MPLKLSLKPGEKFVLNGAVVQNGDRRGVLVLQNKASVLREKDIMQPDQVTTPARHIYFPVMMMYLDEVGAEKFYEEFATRLNEFMGVVRNPVVLQDCIAISKHVMAREYYKALMLSRKLIEYEDERLGHVSSGVSAGGDAG")
00096         self.assertEqual(record.alignments[0].hsps[0].match, "MPLKLSLKPGEKFVLNGAVVQNGDRRGVLVLQNKASVLREKDIMQPDQVTTPARHIYFPVMMMYLDEVGAEKFYEEFATRLNEFMGVVRNPVVLQDCIAISKHVMAREYYKALMLSRKLIEYEDERLGHVSSGVSAGGDAG")
00097         self.assertEqual(record.alignments[0].hsps[0].sbjct, "MPLKLSLKPGEKFVLNGAVVQNGDRRGVLVLQNKASVLREKDIMQPDQVTTPARHIYFPVMMMYLDEVGAEKFYEEFATRLNEFMGVVRNPVVLQDCIAISKHVMAREYYKALMLSRKLIEYEDERLGHVSSGVSAGGDAG")
00098         self.assertEqual(record.alignments[0].hsps[0].query_start, 1)
00099         self.assertEqual(record.alignments[0].hsps[0].query_end, 141)
00100         self.assertEqual(record.alignments[0].hsps[0].sbjct_start, 1)
00101         self.assertEqual(record.alignments[0].hsps[0].sbjct_end, 141)
00102         self.assertEqual(record.alignments[1].hsps[0].query, "VLVLQNKASVLREKDIMQPDQVTTPARHIYFPVMMMYLDEVGAEKFY")
00103         self.assertEqual(record.alignments[1].hsps[0].match, "+LVL N  ++   K     D  TT   +IY P+ +    +  A+KFY")
00104         self.assertEqual(record.alignments[1].hsps[0].sbjct, "ILVLINNTNITELKKFEDDDYYTTFQHYIYQPIFIFTTYDSKAKKFY")
00105         self.assertEqual(record.alignments[1].hsps[0].query_start, 28)
00106         self.assertEqual(record.alignments[1].hsps[0].query_end, 74)
00107         self.assertEqual(record.alignments[1].hsps[0].sbjct_start, 169)
00108         self.assertEqual(record.alignments[1].hsps[0].sbjct_end, 215)
00109         self.assertEqual(record.alignments[2].hsps[0].query, "KASVLREKDIMQPDQVTTPARHIYFPVMMMYLDEVGAEKFYEEFATRLNEFMGVVRNPVVLQDCIAISKHVMAREYYKALMLSRKLIEYEDERLGHVSSGVSAGGDA")
00110         self.assertEqual(record.alignments[2].hsps[0].match, "+A V+ EK I   D+V T       P  +  +     +   EE    L + +GVV +   L+D     + V+A      + ++RKL EY D   G     VSA  DA")
00111         self.assertEqual(record.alignments[2].hsps[0].sbjct, "EAGVIYEKKIF--DEVLTFIEECRDPKAISIILRGSTKHVAEEMERALEDAIGVVAS--TLED-----REVVAGGGAPEVEIARKLREYADTISGREQLAVSAFADA")
00112         self.assertEqual(record.alignments[2].hsps[0].query_start, 34)
00113         self.assertEqual(record.alignments[2].hsps[0].query_end, 140)
00114         self.assertEqual(record.alignments[2].hsps[0].sbjct_start, 339)
00115         self.assertEqual(record.alignments[2].hsps[0].sbjct_end, 436)
00116         self.assertEqual(record.database_name, ['data/swissprot'])
00117         self.assertEqual(record.num_letters_in_database, [29652561])
00118         self.assertEqual(record.num_sequences_in_database, [82258])
00119         self.assertEqual(record.posted_date, [('Nov 15, 1999  2:55 PM',)])
00120         self.assertEqual(len(record.ka_params), 3)
00121         self.assertAlmostEqual(record.ka_params[0], 0.321)
00122         self.assertAlmostEqual(record.ka_params[1], 0.138)
00123         self.assertAlmostEqual(record.ka_params[2], 0.390)
00124         self.assertEqual(len(record.ka_params_gap), 3)
00125         self.assertAlmostEqual(record.ka_params_gap[0], 0.270)
00126         self.assertAlmostEqual(record.ka_params_gap[1], 0.0470)
00127         self.assertAlmostEqual(record.ka_params_gap[2], 0.230)
00128         self.assertEqual(record.matrix, 'BLOSUM62')
00129         self.assertEqual(record.gap_penalties, [11,1])
00130         self.assertEqual(record.num_hits, 7927717)
00131         self.assertEqual(record.num_sequences, 82258)
00132         self.assertEqual(record.num_extends, 284596)
00133         self.assertEqual(record.num_good_extends, 567)
00134         self.assertEqual(record.num_seqs_better_e, 3)
00135         self.assertEqual(record.hsps_no_gap, 2)
00136         self.assertEqual(record.hsps_prelim_gapped, 1)
00137         self.assertEqual(record.hsps_gapped, 3)
00138         self.assertEqual(record.query_length, 141)
00139         self.assertEqual(record.database_length, 29652561)
00140         self.assertEqual(record.effective_hsp_length, 50)
00141         self.assertEqual(record.effective_query_length, 91)
00142         self.assertEqual(record.effective_database_length, 25539661)
00143         self.assertEqual(record.effective_search_space, 2324109151)
00144         self.assertEqual(record.effective_search_space_used, 2324109151)
00145         self.assertEqual(record.threshold, 11)
00146         self.assertEqual(record.window_size, 40)
00147         self.assertEqual(len(record.dropoff_1st_pass), 2)
00148         self.assertEqual(record.dropoff_1st_pass[0], 16)
00149         self.assertAlmostEqual(record.dropoff_1st_pass[1], 7.4)
00150         self.assertEqual(len(record.gap_x_dropoff), 2)
00151         self.assertEqual(record.gap_x_dropoff[0], 38)
00152         self.assertAlmostEqual(record.gap_x_dropoff[1], 14.8)
00153         self.assertEqual(len(record.gap_x_dropoff_final), 2)
00154         self.assertEqual(record.gap_x_dropoff_final[0], 64)
00155         self.assertAlmostEqual(record.gap_x_dropoff_final[1], 24.9)
00156         self.assertEqual(len(record.gap_trigger), 2)
00157         self.assertEqual(record.gap_trigger[0], 41)
00158         self.assertAlmostEqual(record.gap_trigger[1], 21.8)
00159         self.assertEqual(len(record.blast_cutoff), 2)
00160         self.assertEqual(record.blast_cutoff[0], 61)
00161         self.assertAlmostEqual(record.blast_cutoff[1], 28.2)

Here is the call graph for this function:

Definition at line 162 of file test_NCBITextParser.py.

00162 
00163     def test_bt002(self):
00164         "Test parsing BLASTP 2.0.10 output without hits (bt002)"
00165 
00166         path = os.path.join('Blast', 'bt002.txt')
00167         handle = open(path)
00168         record = self.parser.parse(handle)
00169         handle.close()
00170         self.assertEqual(record.application, "BLASTP")
00171         self.assertEqual(record.version, '2.0.10')
00172         self.assertEqual(record.date, "Aug-26-1999")
00173         self.assertEqual(record.reference, TestNCBITextParser.reference)
00174         self.assertEqual(record.query, "gi|400206|sp|Q02112|LYTA_BACSU MEMBRANE-BOUND PROTEIN LYTA\nPRECURSOR")
00175         self.assertEqual(record.query_letters, 102)
00176         self.assertEqual(record.database, "data/pdbaa")
00177         self.assertEqual(record.database_sequences, 6999)
00178         self.assertEqual(record.database_letters, 1461753)
00179         self.assertEqual(len(record.descriptions), 0)
00180         self.assertEqual(len(record.alignments), 0)
00181         self.assertEqual(record.database_name, ['data/pdbaa'])
00182         self.assertEqual(record.num_letters_in_database, [1461753])
00183         self.assertEqual(record.num_sequences_in_database, [6999])
00184         self.assertEqual(record.posted_date, [('Oct 11, 1999 11:30 AM',)])
00185         self.assertEqual(len(record.ka_params), 3)
00186         self.assertAlmostEqual(record.ka_params[0], 0.310)
00187         self.assertAlmostEqual(record.ka_params[1], 0.132)
00188         self.assertAlmostEqual(record.ka_params[2], 0.353)
00189         self.assertEqual(len(record.ka_params_gap), 3)
00190         self.assertAlmostEqual(record.ka_params_gap[0], 0.270)
00191         self.assertAlmostEqual(record.ka_params_gap[1], 0.0470)
00192         self.assertAlmostEqual(record.ka_params_gap[2], 0.230)
00193         self.assertEqual(record.matrix, 'BLOSUM62')
00194         self.assertEqual(record.gap_penalties, [11,1])
00195         self.assertEqual(record.num_hits, 289135)
00196         self.assertEqual(record.num_sequences, 6999)
00197         self.assertEqual(record.num_extends, 10742)
00198         self.assertEqual(record.num_good_extends, 10)
00199         self.assertEqual(record.num_seqs_better_e, 0)
00200         self.assertEqual(record.hsps_no_gap, 0)
00201         self.assertEqual(record.hsps_prelim_gapped, 0)
00202         self.assertEqual(record.hsps_gapped, 0)
00203         self.assertEqual(record.query_length, 102)
00204         self.assertEqual(record.database_length, 1461753)
00205         self.assertEqual(record.effective_hsp_length, 45)
00206         self.assertEqual(record.effective_query_length, 57)
00207         self.assertEqual(record.effective_database_length, 1146798)
00208         self.assertEqual(record.effective_search_space, 65367486)
00209         self.assertEqual(record.effective_search_space_used, 65367486)
00210         self.assertEqual(record.threshold, 11)
00211         self.assertEqual(record.window_size, 40)
00212         self.assertEqual(len(record.dropoff_1st_pass), 2)
00213         self.assertEqual(record.dropoff_1st_pass[0], 16)
00214         self.assertAlmostEqual(record.dropoff_1st_pass[1], 7.1)
00215         self.assertEqual(len(record.gap_x_dropoff), 2)
00216         self.assertEqual(record.gap_x_dropoff[0], 38)
00217         self.assertAlmostEqual(record.gap_x_dropoff[1], 14.8)
00218         self.assertEqual(len(record.gap_x_dropoff_final), 2)
00219         self.assertEqual(record.gap_x_dropoff_final[0], 64)
00220         self.assertAlmostEqual(record.gap_x_dropoff_final[1], 24.9)
00221         self.assertEqual(len(record.gap_trigger), 2)
00222         self.assertEqual(record.gap_trigger[0], 42)
00223         self.assertAlmostEqual(record.gap_trigger[1], 21.7)
00224         self.assertEqual(len(record.blast_cutoff), 2)
00225         self.assertEqual(record.blast_cutoff[0], 47)
00226         self.assertAlmostEqual(record.blast_cutoff[1], 22.7)

Here is the call graph for this function:

Definition at line 227 of file test_NCBITextParser.py.

00227 
00228     def test_bt003(self):
00229         "Test parsing BLASTP 2.0.10 output without descriptions (bt003)"
00230 
00231         path = os.path.join('Blast', 'bt003.txt')
00232         handle = open(path)
00233         record = self.parser.parse(handle)
00234         handle.close()
00235         self.assertEqual(record.application, "BLASTP")
00236         self.assertEqual(record.version, '2.0.10')
00237         self.assertEqual(record.date, "Aug-26-1999")
00238         self.assertEqual(record.reference, TestNCBITextParser.reference)
00239         self.assertEqual(record.query, "gi|1718062|sp|P16153|UTXA_CLODI UTXA PROTEIN")
00240         self.assertEqual(record.query_letters, 166)
00241         self.assertEqual(record.database, "data/swissprot")
00242         self.assertEqual(record.database_sequences, 82258)
00243         self.assertEqual(record.database_letters, 29652561)
00244         self.assertEqual(len(record.descriptions), 0)
00245         self.assertEqual(len(record.alignments), 6)
00246         self.assertEqual(record.alignments[0].title, ">gi|1718062|sp|P16153|UTXA_CLODI UTXA PROTEIN")
00247         self.assertEqual(record.alignments[0].length, 166)
00248         self.assertEqual(record.alignments[1].title, ">gi|140528|sp|P24811|YQXH_BACSU HYPOTHETICAL 15.7 KD PROTEIN IN SPOIIIC-CWLA INTERGENIC REGION (ORF2)")
00249         self.assertEqual(record.alignments[1].length, 140)
00250         self.assertEqual(record.alignments[2].title, ">gi|141088|sp|P26835|YNGD_CLOPE HYPOTHETICAL 14.9 KD PROTEIN IN NAGH 3'REGION (ORFD)")
00251         self.assertEqual(record.alignments[2].length, 132)
00252         self.assertEqual(record.alignments[3].title, ">gi|6014830|sp|O78935|CYB_MARAM CYTOCHROME B")
00253         self.assertEqual(record.alignments[3].length, 379)
00254         self.assertEqual(record.alignments[4].title, ">gi|1351589|sp|P47694|Y456_MYCGE HYPOTHETICAL PROTEIN MG456")
00255         self.assertEqual(record.alignments[4].length, 334)
00256         self.assertEqual(record.alignments[5].title, ">gi|2496246|sp|Q57881|Y439_METJA HYPOTHETICAL ATP-BINDING PROTEIN MJ0439")
00257         self.assertEqual(record.alignments[5].length, 361)
00258         self.assertEqual(record.alignments[0].hsps[0].score, 843)
00259         self.assertAlmostEqual(record.alignments[0].hsps[0].bits, 332)
00260         self.assertAlmostEqual(record.alignments[0].hsps[0].expect, 2e-91)
00261         self.assertEqual(len(record.alignments[0].hsps), 1)
00262         self.assertEqual(record.alignments[1].hsps[0].score, 90)
00263         self.assertAlmostEqual(record.alignments[1].hsps[0].bits, 39.5)
00264         self.assertAlmostEqual(record.alignments[1].hsps[0].expect, 0.004)
00265         self.assertEqual(len(record.alignments[1].hsps), 1)
00266         self.assertEqual(record.alignments[2].hsps[0].score, 88)
00267         self.assertAlmostEqual(record.alignments[2].hsps[0].bits, 38.7)
00268         self.assertAlmostEqual(record.alignments[2].hsps[0].expect, 0.007)
00269         self.assertEqual(len(record.alignments[2].hsps), 1)
00270         self.assertEqual(record.alignments[3].hsps[0].score, 64)
00271         self.assertAlmostEqual(record.alignments[3].hsps[0].bits, 29.3)
00272         self.assertAlmostEqual(record.alignments[3].hsps[0].expect, 4.6)
00273         self.assertEqual(len(record.alignments[3].hsps), 1)
00274         self.assertEqual(record.alignments[4].hsps[0].score, 63)
00275         self.assertAlmostEqual(record.alignments[4].hsps[0].bits, 29.0)
00276         self.assertAlmostEqual(record.alignments[4].hsps[0].expect, 6.0)
00277         self.assertEqual(len(record.alignments[4].hsps), 1)
00278         self.assertEqual(record.alignments[5].hsps[0].score, 62)
00279         self.assertAlmostEqual(record.alignments[5].hsps[0].bits, 28.6)
00280         self.assertAlmostEqual(record.alignments[5].hsps[0].expect, 7.8)
00281         self.assertEqual(len(record.alignments[5].hsps), 1)
00282         self.assertEqual(record.alignments[0].hsps[0].identities, (166, 166))
00283         self.assertEqual(record.alignments[0].hsps[0].positives, (166, 166))
00284         self.assertEqual(record.alignments[1].hsps[0].identities, (27, 130))
00285         self.assertEqual(record.alignments[1].hsps[0].positives, (55, 130))
00286         self.assertEqual(record.alignments[1].hsps[0].gaps, (19, 130))
00287         self.assertEqual(record.alignments[2].hsps[0].identities, (24, 110))
00288         self.assertEqual(record.alignments[2].hsps[0].positives, (52, 110))
00289         self.assertEqual(record.alignments[2].hsps[0].gaps, (18, 110))
00290         self.assertEqual(record.alignments[3].hsps[0].identities, (19, 57))
00291         self.assertEqual(record.alignments[3].hsps[0].positives, (33, 57))
00292         self.assertEqual(record.alignments[3].hsps[0].gaps, (2, 57))
00293         self.assertEqual(record.alignments[4].hsps[0].identities, (16, 44))
00294         self.assertEqual(record.alignments[4].hsps[0].positives, (24, 44))
00295         self.assertEqual(record.alignments[4].hsps[0].gaps, (2, 44))
00296         self.assertEqual(record.alignments[5].hsps[0].identities, (19, 56))
00297         self.assertEqual(record.alignments[5].hsps[0].positives, (30, 56))
00298         self.assertEqual(record.alignments[5].hsps[0].gaps, (12, 56))
00299         self.assertEqual(record.alignments[0].hsps[0].query, "MHSSSPFYISNGNKIFFYINLGGVMNMTISFLSEHIFIKLVILTISFDTLLGCLSAIKSRKFNSSFGIDGGIRKVAMIACIFFLSVVDILTKFNFLFMLPQDCINFLRLKHLGISEFFSILFILYESVSILKNMCLCGLPVPKRLKEKIAILLDAMTDEMNAKDEK")
00300         self.assertEqual(record.alignments[0].hsps[0].match, "MHSSSPFYISNGNKIFFYINLGGVMNMTISFLSEHIFIKLVILTISFDTLLGCLSAIKSRKFNSSFGIDGGIRKVAMIACIFFLSVVDILTKFNFLFMLPQDCINFLRLKHLGISEFFSILFILYESVSILKNMCLCGLPVPKRLKEKIAILLDAMTDEMNAKDEK")
00301         self.assertEqual(record.alignments[0].hsps[0].sbjct, "MHSSSPFYISNGNKIFFYINLGGVMNMTISFLSEHIFIKLVILTISFDTLLGCLSAIKSRKFNSSFGIDGGIRKVAMIACIFFLSVVDILTKFNFLFMLPQDCINFLRLKHLGISEFFSILFILYESVSILKNMCLCGLPVPKRLKEKIAILLDAMTDEMNAKDEK")
00302         self.assertEqual(record.alignments[0].hsps[0].query_start, 1)
00303         self.assertEqual(record.alignments[0].hsps[0].query_end, 166)
00304         self.assertEqual(record.alignments[0].hsps[0].sbjct_start, 1)
00305         self.assertEqual(record.alignments[0].hsps[0].sbjct_end, 166)
00306         self.assertEqual(record.alignments[1].hsps[0].query, "FIKLVILTISFDTLLGCLSAIKSRKFNSSFGIDGGIRKVAMIACIFFLSVVDILTKFNFLFMLPQDCINFLRLKHLGISEFFSILF-ILYESVSILKNMCLCGLPVPKRLKEKIAILLDAMTDEMNAKDE")
00307         self.assertEqual(record.alignments[1].hsps[0].match, "++ L+++    D L G + A K +K  S     G +RK+     +   +V+D +   N                  G+  F ++LF I  E +SI +N+   G+ +P  + +++  + +      N  D+")
00308         self.assertEqual(record.alignments[1].hsps[0].sbjct, "YLDLLLVLSIIDVLTGVIKAWKFKKLRSRSAWFGYVRKLLNFFAVILANVIDTVLNLN------------------GVLTFGTVLFYIANEGLSITENLAQIGVKIPSSITDRLQTIENEKEQSKNNADK")
00309         self.assertEqual(record.alignments[1].hsps[0].query_start, 37)
00310         self.assertEqual(record.alignments[1].hsps[0].query_end, 165)
00311         self.assertEqual(record.alignments[1].hsps[0].sbjct_start, 26)
00312         self.assertEqual(record.alignments[1].hsps[0].sbjct_end, 137)
00313         self.assertEqual(record.alignments[2].hsps[0].query, "VILTISFDTLLGCLSAIKSRKFNSSFGIDGGIRKVAMIACIFFLSVVD-ILTKFNFLFMLPQDCINFLRLKHLGISEFFSILFILYESVSILKNMCLCGLPVPKRLKEKI")
00314         self.assertEqual(record.alignments[2].hsps[0].match, "+++ I  D L G +   KS++  S+ G+ G  +K  ++  +    ++D +L    ++F                     +  +I+ E +SIL+N    G+P+P++LK+ +")
00315         self.assertEqual(record.alignments[2].hsps[0].sbjct, "LLVFIFLDYLTGVIKGCKSKELCSNIGLRGITKKGLILVVLLVAVMLDRLLDNGTWMFRT-----------------LIAYFYIMNEGISILENCAALGVPIPEKLKQAL")
00316         self.assertEqual(record.alignments[2].hsps[0].query_start, 41)
00317         self.assertEqual(record.alignments[2].hsps[0].query_end, 149)
00318         self.assertEqual(record.alignments[2].hsps[0].sbjct_start, 33)
00319         self.assertEqual(record.alignments[2].hsps[0].sbjct_end, 125)
00320         self.assertEqual(record.alignments[3].hsps[0].query, "CIFFLSVVDILTKFNFLFMLPQDCINFLRLKHLGISEFFSILFILYESVSILKNMCL")
00321         self.assertEqual(record.alignments[3].hsps[0].match, "C+F+L V D+LT   ++   P +   F+ +  L    +F+IL IL  ++SI++N  L")
00322         self.assertEqual(record.alignments[3].hsps[0].sbjct, "CLFWLLVADLLT-LTWIGGQPVEH-PFITIGQLASILYFAILLILMPAISIIENNLL")
00323         self.assertEqual(record.alignments[3].hsps[0].query_start, 80)
00324         self.assertEqual(record.alignments[3].hsps[0].query_end, 136)
00325         self.assertEqual(record.alignments[3].hsps[0].sbjct_start, 323)
00326         self.assertEqual(record.alignments[3].hsps[0].sbjct_end, 377)
00327         self.assertEqual(record.alignments[4].hsps[0].query, "LTKFNFLFMLPQDCINFLRLKHLGISEFFSILFILYESVSILKN")
00328         self.assertEqual(record.alignments[4].hsps[0].match, "LTKFN  F+ P     FLR+  +G+   FS++ I +   S  +N")
00329         self.assertEqual(record.alignments[4].hsps[0].sbjct, "LTKFNKFFLTPNKLNAFLRV--IGLCGLFSVIAISFGIYSYTRN")
00330         self.assertEqual(record.alignments[4].hsps[0].query_start, 90)
00331         self.assertEqual(record.alignments[4].hsps[0].query_end, 133)
00332         self.assertEqual(record.alignments[4].hsps[0].sbjct_start, 4)
00333         self.assertEqual(record.alignments[4].hsps[0].sbjct_end, 45)
00334         self.assertEqual(record.alignments[5].hsps[0].query, "FLRLKHLGIS---EFFSILFILYES----VSILKNMC-----LCGLPVPKRLKEKI")
00335         self.assertEqual(record.alignments[5].hsps[0].match, "++ L+ + IS   +F  +LF  YE     V I+K++      LCG+P PK   E+I")
00336         self.assertEqual(record.alignments[5].hsps[0].sbjct, "YINLRGIFISKYKDFIEVLFEEYEEDRKPVEIIKSLIKDVPSLCGIPTPKNTLEEI")
00337         self.assertEqual(record.alignments[5].hsps[0].query_start, 106)
00338         self.assertEqual(record.alignments[5].hsps[0].query_end, 149)
00339         self.assertEqual(record.alignments[5].hsps[0].sbjct_start, 68)
00340         self.assertEqual(record.alignments[5].hsps[0].sbjct_end, 123)
00341         self.assertEqual(record.database_name, ['data/swissprot'])
00342         self.assertEqual(record.num_letters_in_database, [29652561])
00343         self.assertEqual(record.num_sequences_in_database, [82258])
00344         self.assertEqual(record.posted_date, [('Nov 15, 1999  2:55 PM',)])
00345         self.assertEqual(len(record.ka_params), 3)
00346         self.assertAlmostEqual(record.ka_params[0], 0.331)
00347         self.assertAlmostEqual(record.ka_params[1], 0.146)
00348         self.assertAlmostEqual(record.ka_params[2], 0.428)
00349         self.assertEqual(len(record.ka_params_gap), 3)
00350         self.assertAlmostEqual(record.ka_params_gap[0], 0.270)
00351         self.assertAlmostEqual(record.ka_params_gap[1], 0.0470)
00352         self.assertAlmostEqual(record.ka_params_gap[2], 0.230)
00353         self.assertEqual(record.matrix, 'BLOSUM62')
00354         self.assertEqual(record.gap_penalties, [11,1])
00355         self.assertEqual(record.num_hits, 8801581)
00356         self.assertEqual(record.num_sequences, 82258)
00357         self.assertEqual(record.num_extends, 320828)
00358         self.assertEqual(record.num_good_extends, 892)
00359         self.assertEqual(record.num_seqs_better_e, 6)
00360         self.assertEqual(record.hsps_no_gap, 3)
00361         self.assertEqual(record.hsps_prelim_gapped, 3)
00362         self.assertEqual(record.hsps_gapped, 6)
00363         self.assertEqual(record.query_length, 166)
00364         self.assertEqual(record.database_length, 29652561)
00365         self.assertEqual(record.effective_hsp_length, 46)
00366         self.assertEqual(record.effective_query_length, 120)
00367         self.assertEqual(record.effective_database_length, 25868693)
00368         self.assertEqual(record.effective_search_space, 3104243160)
00369         self.assertEqual(record.effective_search_space_used, 3104243160)
00370         self.assertEqual(record.threshold, 11)
00371         self.assertEqual(record.window_size, 40)
00372         self.assertEqual(len(record.dropoff_1st_pass), 2)
00373         self.assertEqual(record.dropoff_1st_pass[0], 15)
00374         self.assertAlmostEqual(record.dropoff_1st_pass[1], 7.2)
00375         self.assertEqual(len(record.gap_x_dropoff), 2)
00376         self.assertEqual(record.gap_x_dropoff[0], 38)
00377         self.assertAlmostEqual(record.gap_x_dropoff[1], 14.8)
00378         self.assertEqual(len(record.gap_x_dropoff_final), 2)
00379         self.assertEqual(record.gap_x_dropoff_final[0], 64)
00380         self.assertAlmostEqual(record.gap_x_dropoff_final[1], 24.9)
00381         self.assertEqual(len(record.gap_trigger), 2)
00382         self.assertEqual(record.gap_trigger[0], 40)
00383         self.assertAlmostEqual(record.gap_trigger[1], 21.9)
00384         self.assertEqual(len(record.blast_cutoff), 2)
00385         self.assertEqual(record.blast_cutoff[0], 62)
00386         self.assertAlmostEqual(record.blast_cutoff[1], 28.6)

Here is the call graph for this function:

Definition at line 387 of file test_NCBITextParser.py.

00387 
00388     def test_bt004(self):
00389         "Test parsing BLASTP 2.0.10 output without alignments (bt004)"
00390 
00391         path = os.path.join('Blast', 'bt004.txt')
00392         handle = open(path)
00393         record = self.parser.parse(handle)
00394         handle.close()
00395         self.assertEqual(record.application, "BLASTP")
00396         self.assertEqual(record.version, '2.0.10')
00397         self.assertEqual(record.date, "Aug-26-1999")
00398         self.assertEqual(record.reference, TestNCBITextParser.reference)
00399         self.assertEqual(record.query, "gi|1718062|sp|P16153|UTXA_CLODI UTXA PROTEIN")
00400         self.assertEqual(record.query_letters, 166)
00401         self.assertEqual(record.database, "data/swissprot")
00402         self.assertEqual(record.database_sequences, 82258)
00403         self.assertEqual(record.database_letters, 29652561)
00404         self.assertEqual(len(record.descriptions), 6)
00405         self.assertEqual(record.descriptions[0].title, "gi|1718062|sp|P16153|UTXA_CLODI UTXA PROTEIN")
00406         self.assertEqual(record.descriptions[0].score, 332)
00407         self.assertAlmostEqual(record.descriptions[0].e, 2.e-91)
00408         self.assertEqual(record.descriptions[1].title, "gi|140528|sp|P24811|YQXH_BACSU HYPOTHETICAL 15.7 KD PROTEIN IN ...")
00409         self.assertEqual(record.descriptions[1].score, 39)
00410         self.assertAlmostEqual(record.descriptions[1].e, 0.004)
00411         self.assertEqual(record.descriptions[2].title, "gi|141088|sp|P26835|YNGD_CLOPE HYPOTHETICAL 14.9 KD PROTEIN IN ...")
00412         self.assertEqual(record.descriptions[2].score, 39)
00413         self.assertAlmostEqual(record.descriptions[2].e, 0.007)
00414         self.assertEqual(record.descriptions[3].title, "gi|6014830|sp|O78935|CYB_MARAM CYTOCHROME B")
00415         self.assertEqual(record.descriptions[3].score, 29)
00416         self.assertAlmostEqual(record.descriptions[3].e, 4.6)
00417         self.assertEqual(record.descriptions[4].title, "gi|1351589|sp|P47694|Y456_MYCGE HYPOTHETICAL PROTEIN MG456")
00418         self.assertEqual(record.descriptions[4].score, 29)
00419         self.assertAlmostEqual(record.descriptions[4].e, 6.0)
00420         self.assertEqual(record.descriptions[5].title, "gi|2496246|sp|Q57881|Y439_METJA HYPOTHETICAL ATP-BINDING PROTEI...")
00421         self.assertEqual(record.descriptions[5].score, 29)
00422         self.assertAlmostEqual(record.descriptions[5].e, 7.8)
00423         self.assertEqual(len(record.alignments), 0)
00424         self.assertEqual(record.database_name, ['data/swissprot'])
00425         self.assertEqual(record.num_letters_in_database, [29652561])
00426         self.assertEqual(record.num_sequences_in_database, [82258])
00427         self.assertEqual(record.posted_date, [('Nov 15, 1999  2:55 PM',)])
00428         self.assertEqual(len(record.ka_params), 3)
00429         self.assertAlmostEqual(record.ka_params[0], 0.331)
00430         self.assertAlmostEqual(record.ka_params[1], 0.146)
00431         self.assertAlmostEqual(record.ka_params[2], 0.428)
00432         self.assertEqual(len(record.ka_params_gap), 3)
00433         self.assertAlmostEqual(record.ka_params_gap[0], 0.270)
00434         self.assertAlmostEqual(record.ka_params_gap[1], 0.0470)
00435         self.assertAlmostEqual(record.ka_params_gap[2], 0.230)
00436         self.assertEqual(record.matrix, 'BLOSUM62')
00437         self.assertEqual(record.gap_penalties, [11,1])
00438         self.assertEqual(record.num_hits, 8801581)
00439         self.assertEqual(record.num_sequences, 82258)
00440         self.assertEqual(record.num_extends, 320828)
00441         self.assertEqual(record.num_good_extends, 892)
00442         self.assertEqual(record.num_seqs_better_e, 6)
00443         self.assertEqual(record.hsps_no_gap, 3)
00444         self.assertEqual(record.hsps_prelim_gapped, 3)
00445         self.assertEqual(record.hsps_gapped, 6)
00446         self.assertEqual(record.query_length, 166)
00447         self.assertEqual(record.database_length, 29652561)
00448         self.assertEqual(record.effective_hsp_length, 46)
00449         self.assertEqual(record.effective_query_length, 120)
00450         self.assertEqual(record.effective_database_length, 25868693)
00451         self.assertEqual(record.effective_search_space, 3104243160)
00452         self.assertEqual(record.effective_search_space_used, 3104243160)
00453         self.assertEqual(record.threshold, 11)
00454         self.assertEqual(record.window_size, 40)
00455         self.assertEqual(len(record.dropoff_1st_pass), 2)
00456         self.assertEqual(record.dropoff_1st_pass[0], 15)
00457         self.assertAlmostEqual(record.dropoff_1st_pass[1], 7.2)
00458         self.assertEqual(len(record.gap_x_dropoff), 2)
00459         self.assertEqual(record.gap_x_dropoff[0], 38)
00460         self.assertAlmostEqual(record.gap_x_dropoff[1], 14.8)
00461         self.assertEqual(len(record.gap_x_dropoff_final), 2)
00462         self.assertEqual(record.gap_x_dropoff_final[0], 64)
00463         self.assertAlmostEqual(record.gap_x_dropoff_final[1], 24.9)
00464         self.assertEqual(len(record.gap_trigger), 2)
00465         self.assertEqual(record.gap_trigger[0], 40)
00466         self.assertAlmostEqual(record.gap_trigger[1], 21.9)
00467         self.assertEqual(len(record.blast_cutoff), 2)
00468         self.assertEqual(record.blast_cutoff[0], 62)
00469         self.assertAlmostEqual(record.blast_cutoff[1], 28.6)

Here is the call graph for this function:

Definition at line 470 of file test_NCBITextParser.py.

00470 
00471     def test_bt005(self):
00472         "Test parsing BLASTP 2.0.10 output (bt005)"
00473 
00474         path = os.path.join('Blast', 'bt005.txt')
00475         handle = open(path)
00476         record = self.parser.parse(handle)
00477         handle.close()
00478         self.assertEqual(record.application, "BLASTP")
00479         self.assertEqual(record.version, '2.0.10')
00480         self.assertEqual(record.date, "Aug-26-1999")
00481         self.assertEqual(record.reference, TestNCBITextParser.reference)
00482         self.assertEqual(record.query, "gi|132349|sp|P15394|REPA_AGRTU REPLICATING PROTEIN")
00483         self.assertEqual(record.query_letters, 250)
00484         self.assertEqual(record.database, "data/swissprot")
00485         self.assertEqual(record.database_sequences, 82258)
00486         self.assertEqual(record.database_letters, 29652561)
00487         self.assertEqual(len(record.descriptions), 15)
00488         self.assertEqual(record.descriptions[0].title, "gi|132349|sp|P15394|REPA_AGRTU REPLICATING PROTEIN")
00489         self.assertEqual(record.descriptions[0].score, 514)
00490         self.assertAlmostEqual(record.descriptions[0].e, 1.e-146)
00491         self.assertEqual(record.descriptions[1].title, "gi|123932|sp|P19922|HYIN_BRAJA INDOLEACETAMIDE HYDROLASE (IAH) ...")
00492         self.assertEqual(record.descriptions[1].score, 34)
00493         self.assertAlmostEqual(record.descriptions[1].e, 0.29)
00494         self.assertEqual(record.descriptions[2].title, "gi|137670|sp|P06422|VE2_HPV08 REGULATORY PROTEIN E2")
00495         self.assertEqual(record.descriptions[2].score, 32)
00496         self.assertAlmostEqual(record.descriptions[2].e, 0.86)
00497         self.assertEqual(record.descriptions[3].title, "gi|5921693|sp|Q05152|CCAB_RABIT VOLTAGE-DEPENDENT N-TYPE CALCIU...")
00498         self.assertEqual(record.descriptions[3].score, 32)
00499         self.assertAlmostEqual(record.descriptions[3].e, 1.5)
00500         self.assertEqual(record.descriptions[4].title, "gi|121952|sp|P02256|H1_PARAN HISTONE H1, GONADAL")
00501         self.assertEqual(record.descriptions[4].score, 31)
00502         self.assertAlmostEqual(record.descriptions[4].e, 2.5)
00503         self.assertEqual(record.descriptions[5].title, "gi|124141|sp|P08392|ICP4_HSV11 TRANS-ACTING TRANSCRIPTIONAL PRO...")
00504         self.assertEqual(record.descriptions[5].score, 31)
00505         self.assertAlmostEqual(record.descriptions[5].e, 3.3)
00506         self.assertEqual(record.descriptions[6].title, "gi|3915729|sp|P51592|HYDP_DROME HYPERPLASTIC DISCS PROTEIN (HYD...")
00507         self.assertEqual(record.descriptions[6].score, 31)
00508         self.assertAlmostEqual(record.descriptions[6].e, 3.3)
00509         self.assertEqual(record.descriptions[7].title, "gi|462182|sp|P33438|GLT_DROME GLUTACTIN PRECURSOR")
00510         self.assertEqual(record.descriptions[7].score, 31)
00511         self.assertAlmostEqual(record.descriptions[7].e, 3.3)
00512         self.assertEqual(record.descriptions[8].title, "gi|731294|sp|P39713|YAG1_YEAST HYPOTHETICAL ZINC-TYPE ALCOHOL D...")
00513         self.assertEqual(record.descriptions[8].score, 30)
00514         self.assertAlmostEqual(record.descriptions[8].e, 4.3)
00515         self.assertEqual(record.descriptions[9].title, "gi|1708851|sp|P55268|LMB2_HUMAN LAMININ BETA-2 CHAIN PRECURSOR ...")
00516         self.assertEqual(record.descriptions[9].score, 30)
00517         self.assertAlmostEqual(record.descriptions[9].e, 4.3)
00518         self.assertEqual(record.descriptions[10].title, "gi|2495137|sp|Q24704|H1_DROVI HISTONE H1")
00519         self.assertEqual(record.descriptions[10].score, 29)
00520         self.assertAlmostEqual(record.descriptions[10].e, 7.5)
00521         self.assertEqual(record.descriptions[11].title, "gi|1172635|sp|P46466|PRS4_ORYSA 26S PROTEASE REGULATORY SUBUNIT...")
00522         self.assertEqual(record.descriptions[11].score, 29)
00523         self.assertAlmostEqual(record.descriptions[11].e, 9.8)
00524         self.assertEqual(record.descriptions[12].title, "gi|6093970|sp|Q61085|RHOP_MOUSE GTP-RHO BINDING PROTEIN 1 (RHOP...")
00525         self.assertEqual(record.descriptions[12].score, 29)
00526         self.assertAlmostEqual(record.descriptions[12].e, 9.8)
00527         self.assertEqual(record.descriptions[13].title, "gi|547963|sp|Q01989|MYS9_DROME MYOSIN HEAVY CHAIN 95F (95F MHC)")
00528         self.assertEqual(record.descriptions[13].score, 29)
00529         self.assertAlmostEqual(record.descriptions[13].e, 9.8)
00530         self.assertEqual(record.descriptions[14].title, "gi|6226905|sp|Q59567|TOP1_MYCTU DNA TOPOISOMERASE I (OMEGA-PROT...")
00531         self.assertEqual(record.descriptions[14].score, 29)
00532         self.assertAlmostEqual(record.descriptions[14].e, 9.8)
00533         self.assertEqual(len(record.alignments), 0)
00534         self.assertEqual(record.database_name, ['data/swissprot'])
00535         self.assertEqual(record.num_letters_in_database, [29652561])
00536         self.assertEqual(record.num_sequences_in_database, [82258])
00537         self.assertEqual(record.posted_date, [('Nov 15, 1999  2:55 PM',)])
00538         self.assertEqual(len(record.ka_params), 3)
00539         self.assertAlmostEqual(record.ka_params[0], 0.317)
00540         self.assertAlmostEqual(record.ka_params[1], 0.133)
00541         self.assertAlmostEqual(record.ka_params[2], 0.395)
00542         self.assertEqual(len(record.ka_params_gap), 3)
00543         self.assertAlmostEqual(record.ka_params_gap[0], 0.270)
00544         self.assertAlmostEqual(record.ka_params_gap[1], 0.0470)
00545         self.assertAlmostEqual(record.ka_params_gap[2], 0.230)
00546         self.assertEqual(record.matrix, 'BLOSUM62')
00547         self.assertEqual(record.gap_penalties, [11,1])
00548         self.assertEqual(record.num_hits, 14679054)
00549         self.assertEqual(record.num_sequences, 82258)
00550         self.assertEqual(record.num_extends, 599117)
00551         self.assertEqual(record.num_good_extends, 1508)
00552         self.assertEqual(record.num_seqs_better_e, 15)
00553         self.assertEqual(record.hsps_no_gap, 4)
00554         self.assertEqual(record.hsps_prelim_gapped, 11)
00555         self.assertEqual(record.hsps_gapped, 15)
00556         self.assertEqual(record.query_length, 250)
00557         self.assertEqual(record.database_length, 29652561)
00558         self.assertEqual(record.effective_hsp_length, 51)
00559         self.assertEqual(record.effective_query_length, 199)
00560         self.assertEqual(record.effective_database_length, 25457403)
00561         self.assertEqual(record.effective_search_space, 5066023197)
00562         self.assertEqual(record.effective_search_space_used, 5066023197)
00563         self.assertEqual(record.threshold, 11)
00564         self.assertEqual(record.window_size, 40)
00565         self.assertEqual(len(record.dropoff_1st_pass), 2)
00566         self.assertEqual(record.dropoff_1st_pass[0], 16)
00567         self.assertAlmostEqual(record.dropoff_1st_pass[1], 7.3)
00568         self.assertEqual(len(record.gap_x_dropoff), 2)
00569         self.assertEqual(record.gap_x_dropoff[0], 38)
00570         self.assertAlmostEqual(record.gap_x_dropoff[1], 14.8)
00571         self.assertEqual(len(record.gap_x_dropoff_final), 2)
00572         self.assertEqual(record.gap_x_dropoff_final[0], 64)
00573         self.assertAlmostEqual(record.gap_x_dropoff_final[1], 24.9)
00574         self.assertEqual(len(record.gap_trigger), 2)
00575         self.assertEqual(record.gap_trigger[0], 41)
00576         self.assertAlmostEqual(record.gap_trigger[1], 21.7)
00577         self.assertEqual(len(record.blast_cutoff), 2)
00578         self.assertEqual(record.blast_cutoff[0], 63)
00579         self.assertAlmostEqual(record.blast_cutoff[1], 29.0)

Here is the call graph for this function:

Definition at line 580 of file test_NCBITextParser.py.

00580 
00581     def test_bt006(self):
00582         "Test parsing PHI-BLAST, BLASTP 2.0.10 output, one round (bt006)"
00583 
00584         path = os.path.join('Blast', 'bt006.txt')
00585         handle = open(path)
00586         record = self.pb_parser.parse(handle)
00587         handle.close()
00588         self.assertEqual(record.application, "BLASTP")
00589         self.assertEqual(record.version, '2.0.10')
00590         self.assertEqual(record.date, "Aug-26-1999")
00591         self.assertEqual(record.reference, TestNCBITextParser.reference)
00592         self.assertEqual(record.query, "gi|1174726|sp|P12921|TMRB_BACSU TUNICAMYCIN RESISTANCE PROTEIN")
00593         self.assertEqual(record.query_letters, 197)
00594         self.assertEqual(record.database, "data/swissprot")
00595         self.assertEqual(record.database_sequences, 82258)
00596         self.assertEqual(record.database_letters, 29652561)
00597         self.assertEqual(len(record.rounds), 1)
00598         self.assertEqual(len(record.rounds[0].new_seqs), 4)
00599         self.assertEqual(record.rounds[0].new_seqs[0].title, "gi|1174726|sp|P12921|TMRB_BACSU TUNICAMYCIN RESISTANCE PROTEIN")
00600         self.assertEqual(record.rounds[0].new_seqs[0].score, 402)
00601         self.assertAlmostEqual(record.rounds[0].new_seqs[0].e, 1.e-112)
00602         self.assertEqual(record.rounds[0].new_seqs[1].title, "gi|1352934|sp|P47169|YJ9F_YEAST HYPOTHETICAL 161.2 KD PROTEIN I...")
00603         self.assertEqual(record.rounds[0].new_seqs[1].score, 30)
00604         self.assertAlmostEqual(record.rounds[0].new_seqs[1].e, 3.3)
00605         self.assertEqual(record.rounds[0].new_seqs[2].title, "gi|3915741|sp|P04407|KITH_HSV23 THYMIDINE KINASE")
00606         self.assertEqual(record.rounds[0].new_seqs[2].score, 29)
00607         self.assertAlmostEqual(record.rounds[0].new_seqs[2].e, 7.4)
00608         self.assertEqual(record.rounds[0].new_seqs[3].title, "gi|3334489|sp|P15398|RPA1_SCHPO DNA-DIRECTED RNA POLYMERASE I 1...")
00609         self.assertEqual(record.rounds[0].new_seqs[3].score, 29)
00610         self.assertAlmostEqual(record.rounds[0].new_seqs[3].e, 7.4)
00611         self.assertEqual(len(record.rounds[0].alignments), 4)
00612         self.assertEqual(record.rounds[0].alignments[0].title, ">gi|1174726|sp|P12921|TMRB_BACSU TUNICAMYCIN RESISTANCE PROTEIN")
00613         self.assertEqual(record.rounds[0].alignments[0].length, 197)
00614         self.assertEqual(record.rounds[0].alignments[1].title, ">gi|1352934|sp|P47169|YJ9F_YEAST HYPOTHETICAL 161.2 KD PROTEIN IN NMD5-HOM6 INTERGENIC REGION")
00615         self.assertEqual(record.rounds[0].alignments[1].length, 1442)
00616         self.assertEqual(record.rounds[0].alignments[2].title, ">gi|3915741|sp|P04407|KITH_HSV23 THYMIDINE KINASE")
00617         self.assertEqual(record.rounds[0].alignments[2].length, 376)
00618         self.assertEqual(record.rounds[0].alignments[3].title, ">gi|3334489|sp|P15398|RPA1_SCHPO DNA-DIRECTED RNA POLYMERASE I 190 KD POLYPEPTIDE")
00619         self.assertEqual(record.rounds[0].alignments[3].length, 1689)
00620         self.assertEqual(record.rounds[0].alignments[0].hsps[0].score, 1021)
00621         self.assertAlmostEqual(record.rounds[0].alignments[0].hsps[0].bits, 402)
00622         self.assertAlmostEqual(record.rounds[0].alignments[0].hsps[0].expect, 1e-112)
00623         self.assertEqual(len(record.rounds[0].alignments[0].hsps), 1)
00624         self.assertEqual(record.rounds[0].alignments[1].hsps[0].score, 66)
00625         self.assertAlmostEqual(record.rounds[0].alignments[1].hsps[0].bits, 30.1)
00626         self.assertAlmostEqual(record.rounds[0].alignments[1].hsps[0].expect, 3.3)
00627         self.assertEqual(len(record.rounds[0].alignments[1].hsps), 1)
00628         self.assertEqual(record.rounds[0].alignments[2].hsps[0].score, 63)
00629         self.assertAlmostEqual(record.rounds[0].alignments[2].hsps[0].bits, 29.0)
00630         self.assertAlmostEqual(record.rounds[0].alignments[2].hsps[0].expect, 7.4)
00631         self.assertEqual(len(record.rounds[0].alignments[2].hsps), 1)
00632         self.assertEqual(record.rounds[0].alignments[3].hsps[0].score, 63)
00633         self.assertAlmostEqual(record.rounds[0].alignments[3].hsps[0].bits, 29.0)
00634         self.assertAlmostEqual(record.rounds[0].alignments[3].hsps[0].expect, 7.4)
00635         self.assertEqual(len(record.rounds[0].alignments[3].hsps), 1)
00636         self.assertEqual(record.rounds[0].alignments[0].hsps[0].identities, (197, 197))
00637         self.assertEqual(record.rounds[0].alignments[0].hsps[0].positives, (197, 197))
00638         self.assertEqual(record.rounds[0].alignments[1].hsps[0].identities, (23, 70))
00639         self.assertEqual(record.rounds[0].alignments[1].hsps[0].positives, (35, 70))
00640         self.assertEqual(record.rounds[0].alignments[1].hsps[0].gaps, (10, 70))
00641         self.assertEqual(record.rounds[0].alignments[2].hsps[0].identities, (15, 37))
00642         self.assertEqual(record.rounds[0].alignments[2].hsps[0].positives, (22, 37))
00643         self.assertEqual(record.rounds[0].alignments[2].hsps[0].gaps, (2, 37))
00644         self.assertEqual(record.rounds[0].alignments[3].hsps[0].identities, (12, 38))
00645         self.assertEqual(record.rounds[0].alignments[3].hsps[0].positives, (20, 38))
00646         self.assertEqual(record.rounds[0].alignments[0].hsps[0].query, "MIIWINGAFGSGKTQTAFELHRRLNPSYVYDPEKMGFALRSMVPQEIAKDDFQSYPLWRAFNYSLLASLTDTYRGILIVPMTIVHPEYFNEIIGRLRQEGRIVHHFTLMASKETLLKRLRTRAEGKNSWAAKQIDRCVEGLSSPIFEDHIQTDNLSIQDVAENIAARAELPLDPDTRGSLRRFADRLMVKLNHIRIK")
00647         self.assertEqual(record.rounds[0].alignments[0].hsps[0].match, "MIIWINGAFGSGKTQTAFELHRRLNPSYVYDPEKMGFALRSMVPQEIAKDDFQSYPLWRAFNYSLLASLTDTYRGILIVPMTIVHPEYFNEIIGRLRQEGRIVHHFTLMASKETLLKRLRTRAEGKNSWAAKQIDRCVEGLSSPIFEDHIQTDNLSIQDVAENIAARAELPLDPDTRGSLRRFADRLMVKLNHIRIK")
00648         self.assertEqual(record.rounds[0].alignments[0].hsps[0].sbjct, "MIIWINGAFGSGKTQTAFELHRRLNPSYVYDPEKMGFALRSMVPQEIAKDDFQSYPLWRAFNYSLLASLTDTYRGILIVPMTIVHPEYFNEIIGRLRQEGRIVHHFTLMASKETLLKRLRTRAEGKNSWAAKQIDRCVEGLSSPIFEDHIQTDNLSIQDVAENIAARAELPLDPDTRGSLRRFADRLMVKLNHIRIK")
00649         self.assertEqual(record.rounds[0].alignments[0].hsps[0].query_start, 1)
00650         self.assertEqual(record.rounds[0].alignments[0].hsps[0].query_end, 197)
00651         self.assertEqual(record.rounds[0].alignments[0].hsps[0].sbjct_start, 1)
00652         self.assertEqual(record.rounds[0].alignments[0].hsps[0].sbjct_end, 197)
00653         self.assertEqual(record.rounds[0].alignments[1].hsps[0].query, "TLMASKETLLKR--------LRTRAEGKNSWAAKQIDRCVEGLSSPIFEDHIQTDNLSIQDVAENIAARA")
00654         self.assertEqual(record.rounds[0].alignments[1].hsps[0].match, "TL+  K+  L R          TR + K S AA   D+ +EGLS P    +  +D  +  ++A+ +AARA")
00655         self.assertEqual(record.rounds[0].alignments[1].hsps[0].sbjct, "TLLTRKDPSLSRNLKQSAGDALTRKQEKRSKAA--FDQLLEGLSGPPLHVYYASDGGNAANLAKRLAARA")
00656         self.assertEqual(record.rounds[0].alignments[1].hsps[0].query_start, 107)
00657         self.assertEqual(record.rounds[0].alignments[1].hsps[0].query_end, 168)
00658         self.assertEqual(record.rounds[0].alignments[1].hsps[0].sbjct_start, 637)
00659         self.assertEqual(record.rounds[0].alignments[1].hsps[0].sbjct_end, 704)
00660         self.assertEqual(record.rounds[0].alignments[2].hsps[0].query, "IWINGAFGSGKTQTAFELHRRLNP--SYVYDPEKMGF")
00661         self.assertEqual(record.rounds[0].alignments[2].hsps[0].match, "++I+G  G GKT T+ +L   L P  + VY PE M +")
00662         self.assertEqual(record.rounds[0].alignments[2].hsps[0].sbjct, "VYIDGPHGVGKTTTSAQLMEALGPRDNIVYVPEPMTY")
00663         self.assertEqual(record.rounds[0].alignments[2].hsps[0].query_start, 3)
00664         self.assertEqual(record.rounds[0].alignments[2].hsps[0].query_end, 37)
00665         self.assertEqual(record.rounds[0].alignments[2].hsps[0].sbjct_start, 52)
00666         self.assertEqual(record.rounds[0].alignments[2].hsps[0].sbjct_end, 88)
00667         self.assertEqual(record.rounds[0].alignments[3].hsps[0].query, "GILIVPMTIVHPEYFNEIIGRLRQEGRIVHHFTLMASK")
00668         self.assertEqual(record.rounds[0].alignments[3].hsps[0].match, "G +++P+   HP +F+++   LR      HHF L   K")
00669         self.assertEqual(record.rounds[0].alignments[3].hsps[0].sbjct, "GHIVLPIPAYHPLFFSQMYNLLRSTCLYCHHFKLSKVK")
00670         self.assertEqual(record.rounds[0].alignments[3].hsps[0].query_start, 75)
00671         self.assertEqual(record.rounds[0].alignments[3].hsps[0].query_end, 112)
00672         self.assertEqual(record.rounds[0].alignments[3].hsps[0].sbjct_start, 78)
00673         self.assertEqual(record.rounds[0].alignments[3].hsps[0].sbjct_end, 115)
00674         self.assertEqual(record.database_name, ['data/swissprot'])
00675         self.assertEqual(record.num_letters_in_database, [29652561])
00676         self.assertEqual(record.num_sequences_in_database, [82258])
00677         self.assertEqual(record.posted_date, [('Nov 15, 1999  2:55 PM',)])
00678         self.assertEqual(len(record.ka_params), 3)
00679         self.assertAlmostEqual(record.ka_params[0], 0.323)
00680         self.assertAlmostEqual(record.ka_params[1], 0.138)
00681         self.assertAlmostEqual(record.ka_params[2], 0.411)
00682         self.assertEqual(len(record.ka_params_gap), 3)
00683         self.assertAlmostEqual(record.ka_params_gap[0], 0.270)
00684         self.assertAlmostEqual(record.ka_params_gap[1], 0.0470)
00685         self.assertAlmostEqual(record.ka_params_gap[2], 0.230)
00686         self.assertEqual(record.matrix, 'BLOSUM62')
00687         self.assertEqual(record.gap_penalties, [11,1])
00688         self.assertEqual(record.num_hits, 11332752)
00689         self.assertEqual(record.num_sequences, 82258)
00690         self.assertEqual(record.num_extends, 435116)
00691         self.assertEqual(record.num_good_extends, 987)
00692         self.assertEqual(record.num_seqs_better_e, 4)
00693         self.assertEqual(record.hsps_no_gap, 2)
00694         self.assertEqual(record.hsps_prelim_gapped, 2)
00695         self.assertEqual(record.hsps_gapped, 4)
00696         self.assertEqual(record.query_length, 197)
00697         self.assertEqual(record.database_length, 29652561)
00698         self.assertEqual(record.effective_hsp_length, 48)
00699         self.assertEqual(record.effective_query_length, 149)
00700         self.assertEqual(record.effective_database_length, 25704177)
00701         self.assertEqual(record.effective_search_space, 3829922373)
00702         self.assertEqual(record.effective_search_space_used, 3829922373)
00703         self.assertEqual(record.threshold, 11)
00704         self.assertEqual(record.window_size, 40)
00705         self.assertEqual(len(record.dropoff_1st_pass), 2)
00706         self.assertEqual(record.dropoff_1st_pass[0], 16)
00707         self.assertAlmostEqual(record.dropoff_1st_pass[1], 7.5)
00708         self.assertEqual(len(record.gap_x_dropoff), 2)
00709         self.assertEqual(record.gap_x_dropoff[0], 38)
00710         self.assertAlmostEqual(record.gap_x_dropoff[1], 14.8)
00711         self.assertEqual(len(record.gap_x_dropoff_final), 2)
00712         self.assertEqual(record.gap_x_dropoff_final[0], 64)
00713         self.assertAlmostEqual(record.gap_x_dropoff_final[1], 24.9)
00714         self.assertEqual(len(record.gap_trigger), 2)
00715         self.assertEqual(record.gap_trigger[0], 41)
00716         self.assertAlmostEqual(record.gap_trigger[1], 22.0)
00717         self.assertEqual(len(record.blast_cutoff), 2)
00718         self.assertEqual(record.blast_cutoff[0], 62)
00719         self.assertAlmostEqual(record.blast_cutoff[1], 28.6)

Here is the call graph for this function:

Definition at line 720 of file test_NCBITextParser.py.

00720 
00721     def test_bt007(self):
00722         "Test parsing PHI-BLAST, BLASTP 2.0.10 output, three rounds (bt007)"
00723 
00724         path = os.path.join('Blast', 'bt007.txt')
00725         handle = open(path)
00726         record = self.pb_parser.parse(handle)
00727         handle.close()
00728         self.assertEqual(record.application, "BLASTP")
00729         self.assertEqual(record.version, '2.0.10')
00730         self.assertEqual(record.date, "Aug-26-1999")
00731         self.assertEqual(record.reference, TestNCBITextParser.reference)
00732         self.assertEqual(record.query, "gi|126343|sp|P17216|LIVK_SALTY LEUCINE-SPECIFIC BINDING PROTEIN\nPRECURSOR (LS-BP) (L-BP)")
00733         self.assertEqual(record.query_letters, 369)
00734         self.assertEqual(record.database, "data/swissprot")
00735         self.assertEqual(record.database_sequences, 82258)
00736         self.assertEqual(record.database_letters, 29652561)
00737         self.assertEqual(len(record.rounds), 3)
00738         self.assertEqual(len(record.rounds[0].new_seqs), 14)
00739         #Rest of test broken up to avoid Jython JVM limitations
00740         self._check_bt007_round0(record)
00741         self._check_bt007_round1(record)
00742         self._check_bt007_round2(record)
00743         self._check_bt007_hsps(record)
00744         self._check_bt007_hsps_details(record)
00745         self._check_bt007_footer(record)

Here is the call graph for this function:

Definition at line 1918 of file test_NCBITextParser.py.

01918 
01919     def test_bt009(self):
01920         "Test parsing PHI-BLAST, BLASTP 2.0.10 output, two rounds (bt009)"
01921 
01922         path = os.path.join('Blast', 'bt009.txt')
01923         handle = open(path)
01924         record = self.pb_parser.parse(handle)
01925         handle.close()
01926         self.assertEqual(record.application, "BLASTP")
01927         self.assertEqual(record.version, '2.0.10')
01928         self.assertEqual(record.date, "Aug-26-1999")
01929         self.assertEqual(record.reference, TestNCBITextParser.reference)
01930         self.assertEqual(record.query, "gi|399896|sp|Q02134|HIS7_LACLA IMIDAZOLEGLYCEROL-PHOSPHATE\nDEHYDRATASE (IGPD)")
01931         self.assertEqual(record.query_letters, 200)
01932         self.assertEqual(record.database, "data/swissprot")
01933         self.assertEqual(record.database_sequences, 82258)
01934         self.assertEqual(record.database_letters, 29652561)
01935         self.assertEqual(len(record.rounds), 2)
01936         self.assertEqual(len(record.rounds[0].new_seqs), 30)
01937         #Rest of test broken up to avoid Jython JVM limitations
01938         self._check_bt009_round0(record)
01939         self._check_bt009_round1(record)
01940         self._check_bt009_hsps(record)
01941         self._check_bt009_hsps_details(record)
01942         self._check_bt009_footer(record)

Here is the call graph for this function:

Definition at line 2953 of file test_NCBITextParser.py.

02953 
02954     def test_bt010(self):
02955         "Test parsing BLASTN 2.0.10 output (bt010)"
02956 
02957         path = os.path.join('Blast', 'bt010.txt')
02958         handle = open(path)
02959         record = self.parser.parse(handle)
02960         handle.close()
02961         self.assertEqual(record.application, "BLASTN")
02962         self.assertEqual(record.version, '2.0.10')
02963         self.assertEqual(record.date, "Aug-26-1999")
02964         self.assertEqual(record.reference, TestNCBITextParser.reference)
02965         self.assertEqual(record.query, "gi|1348916|gb|G26684|G26684 human STS\nSTS_D11570.\x01gi|1375195|gb|G26945|G26945 human STS SHGC-32699.")
02966         self.assertEqual(record.query_letters, 285)
02967         self.assertEqual(record.database, "data/sts"